StarFunc result for job id Q8WWH5

User Input

>input (349 residues)
MAASEAAVVSSPSLKTDTSPVLETAGTVAAMAATPSARAAAAVVAAAARTGSEARVSKAA
LATKLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTL
DSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQE
DIEGILQKFTGNIMQVPPLYSALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQP
PFFTLDVECGGGFYIRSLVSDIGKELSSCANVLELTRTKQGPFTLEEHALPEDKWTIDDI
AQSLEHCSSLFPAELALKKSKPESNEQVLSCEYITLNEPKREDDVIKTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWH5	1.000	1.000	7.155E-66	349	1.000	1.000	Q8WWH5.pdb.gz	TRUB1_HUMAN Pseudouridylate synthase TRUB1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1
2	PDB:1k8wA	0.551	0.629	3.555E-24	304	0.218	0.250	1k8wA.pdb.gz	Cocrystal structure of a tRNA Psi55 pseudouridine synthase: nucleotide flipping by an RNA-modifying enzyme.
3	AFDB:Q0WVR7	0.569	0.374	5.486E-24	540	0.212	0.137	Q0WVR7.pdb.gz	Q0WVR7_ARATH tRNA pseudouridine(55) synthase OS=Arabidopsis thaliana OX=3702 GN=At5g14460 PE=1 SV=1
4	AFDB:P60340	0.554	0.614	3.918E-23	314	0.215	0.239	P60340.pdb.gz	TRUB_ECOLI tRNA pseudouridine synthase B OS=Escherichia coli (strain K12) OX=83333 GN=truB PE=1 SV=1
5	AFDB:Q97QJ3	0.561	0.664	1.762E-22	292	0.226	0.271	Q97QJ3.pdb.gz	TRUB_STRPN tRNA pseudouridine synthase B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=truB PE=1 SV=1
6	AFDB:O59721	0.569	0.491	2.492E-22	407	0.284	0.243	O59721.pdb.gz	PUS4_SCHPO tRNA pseudouridine synthase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11C11.10 PE=1 SV=2
7	AFDB:P48567	0.579	0.505	3.999E-21	403	0.241	0.208	P48567.pdb.gz	PUS4_YEAST tRNA pseudouridine synthase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS4 PE=1 SV=1
8	AFDB:P9WHP7	0.569	0.660	4.237E-21	298	0.235	0.275	P9WHP7.pdb.gz	TRUB_MYCTU tRNA pseudouridine synthase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=truB PE=1 SV=1
9	AFDB:O95900	0.524	0.551	1.271E-20	331	0.275	0.290	O95900.pdb.gz	TRUB2_HUMAN Pseudouridylate synthase TRUB2, mitochondrial OS=Homo sapiens OX=9606 GN=TRUB2 PE=1 SV=1
10	PDB:1sgvB	0.472	0.604	1.927E-16	266	0.201	0.263	1sgvB.pdb.gz
11	PDB:1r3fA	0.476	0.592	4.330E-16	278	0.183	0.230	1r3fA.pdb.gz
12	AFDB:Q57612	0.490	0.508	6.682E-16	336	0.181	0.188	Q57612.pdb.gz	TRUB_METJA Probable tRNA pseudouridine synthase B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=truB PE=1 SV=1
13	AFDB:Q38CM1	0.479	0.394	2.526E-15	427	0.143	0.117	Q38CM1.pdb.gz	Q38CM1_TRYB2 Centromere/microtubule binding protein cbf5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0060 PE=3 SV=1
14	PDB:7v9aC	0.480	0.429	1.312E-14	393	0.155	0.137	7v9aC.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
15	PDB:2rfkA	0.445	0.464	1.115E-13	334	0.166	0.174	2rfkA.pdb.gz	Substrate RNA positioning in the archaeal H/ACA ribonucleoprotein complex.
16	PDB:2apoA	0.443	0.506	2.231E-13	304	0.163	0.188	2apoA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
17	PDB:2v9kA	0.353	0.270	1.882E-7	467	0.117	0.088	2v9kA.pdb.gz	Crystal Structure of Human Pus10, a Novel Pseudouridine Synthase.
18	PDB:2olwA	0.285	0.518	2.035E-5	179	0.089	0.173	2olwA.pdb.gz
19	PDB:3dh3B	0.297	0.408	2.421E-5	241	0.092	0.133	3dh3B.pdb.gz	Crystal structure of an RluF-RNA complex: a base-pair rearrangement is the key to selectivity of RluF for U2604 of the ribosome.
20	PDB:1kskA	0.306	0.429	2.879E-5	234	0.089	0.132	1kskA.pdb.gz	Structure of the 16S rRNA pseudouridine synthase RsuA bound to uracil and UMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WWH5	0.0	707	349	1.000	1.000	TRUB1_HUMAN Pseudouridylate synthase TRUB1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1
2	P60340	7.40e-32	123	314	0.203	0.226	TRUB_ECOLI tRNA pseudouridine synthase B OS=Escherichia coli (strain K12) OX=83333 GN=truB PE=1 SV=1
3	Q0WVR7	3.49e-31	125	540	0.226	0.146	Q0WVR7_ARATH tRNA pseudouridine(55) synthase OS=Arabidopsis thaliana OX=3702 GN=At5g14460 PE=1 SV=1
4	Q97QJ3	1.02e-30	120	292	0.264	0.315	TRUB_STRPN tRNA pseudouridine synthase B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=truB PE=1 SV=1
5	P9WHP7	1.24e-30	120	298	0.221	0.258	TRUB_MYCTU tRNA pseudouridine synthase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=truB PE=1 SV=1
6	O95900	4.35e-28	114	331	0.209	0.221	TRUB2_HUMAN Pseudouridylate synthase TRUB2, mitochondrial OS=Homo sapiens OX=9606 GN=TRUB2 PE=1 SV=1
7	O59721	4.36e-28	115	407	0.232	0.199	PUS4_SCHPO tRNA pseudouridine synthase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11C11.10 PE=1 SV=2
8	P48567	1.06e-23	102	403	0.178	0.154	PUS4_YEAST tRNA pseudouridine synthase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUS4 PE=1 SV=1
9	Q7LWY0	1.46e-19	90.5	340	0.203	0.209	TRUB_PYRFU Probable tRNA pseudouridine synthase B OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=truB PE=1 SV=1
10	Q57612	6.23e-17	82.8	336	0.186	0.193	TRUB_METJA Probable tRNA pseudouridine synthase B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=truB PE=1 SV=1
11	O43100	5.38e-13	72.0	481	0.181	0.131	CBF5_EMENI H/ACA ribonucleoprotein complex subunit CBF5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbf5 PE=2 SV=1
12	Q38CM1	5.94e-13	71.6	427	0.178	0.145	Q38CM1_TRYB2 Centromere/microtubule binding protein cbf5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0060 PE=3 SV=1
13	P33322	6.66e-13	71.6	483	0.178	0.128	CBF5_YEAST H/ACA ribonucleoprotein complex subunit CBF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CBF5 PE=1 SV=1
14	Q5ZJH9	5.93e-12	68.9	516	0.172	0.116	DKC1_CHICK H/ACA ribonucleoprotein complex subunit DKC1 OS=Gallus gallus OX=9031 GN=DKC1 PE=2 SV=1
15	F1Q749	7.59e-12	68.6	506	0.183	0.126	F1Q749_DANRE Dyskeratosis congenita 1, dyskerin OS=Danio rerio OX=7955 GN=fc87a02 PE=1 SV=1
16	O60832	8.26e-12	68.6	514	0.166	0.113	DKC1_HUMAN H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3
17	Q7ZUT3	9.13e-12	68.2	497	0.183	0.129	Q7ZUT3_DANRE Dkc1 protein (Fragment) OS=Danio rerio OX=7955 GN=dkc1 PE=2 SV=1
18	P40615	1.36e-11	67.8	509	0.166	0.114	DKC1_RAT H/ACA ribonucleoprotein complex subunit DKC1 OS=Rattus norvegicus OX=10116 GN=Dkc1 PE=1 SV=4
19	Q9ESX5	1.56e-11	67.4	509	0.178	0.122	DKC1_MOUSE H/ACA ribonucleoprotein complex subunit DKC1 OS=Mus musculus OX=10090 GN=Dkc1 PE=1 SV=4
20	O44081	1.61e-11	67.4	508	0.163	0.112	DKC1_DROME H/ACA ribonucleoprotein complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=Nop60B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16198 TruB_C_2	0.013	26.9	tRNA pseudouridylate synthase B C-terminal domain
2	PF01509 TruB_N	9.9e-47	170.5	TruB family pseudouridylate synthase (N terminal domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298746

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274606	0.982	H/ACA ribonucleoprotein complex subunit 2
2	9606.ENSP00000370589	0.979	Nucleolar protein 56
3	9606.ENSP00000264279	0.977	Nucleolar protein 58
4	9606.ENSP00000226796	0.971	H/ACA ribonucleoprotein complex subunit 1
5	9606.ENSP00000261015	0.962	Ribosome biogenesis protein WDR12
6	9606.ENSP00000346725	0.958	Pescadillo homolog
7	9606.ENSP00000365837	0.954	tRNA pseudouridine synthase A
8	9606.ENSP00000455106	0.953	Ribosome biogenesis protein BOP1
9	9606.ENSP00000364320	0.952	mRNA turnover protein 4 homolog
10	9606.ENSP00000460871	0.948	Ribosomal L1 domain-containing protein 1
11	9606.ENSP00000348722	0.947	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs . Acts as a regulator of protein synthesis in embryonic stem cells by mediating pseudouridylation of RNA fragments derived from tRNAs (tRFs): pseudouridylated tRFs inhibit translation by targeting the translation initiation complex . Also catalyzes pseudouridylation of mRNAs: mediates pseudouridylation of mRNAs with the consensus sequence 5'-UGUAG-3' . In addition to mRNAs and tRNAs, binds other types of RNAs, such as snRNAs, Y RNAs and vault RNAs, suggesting that it can catalyze pseudouridylation of many RNA types
12	9606.ENSP00000332198	0.944	H/ACA ribonucleoprotein complex subunit 3
13	9606.ENSP00000407323	0.942	Probable rRNA-processing protein EBP2
14	9606.ENSP00000238146	0.941	ATP-dependent RNA helicase DDX55
15	9606.ENSP00000254940	0.940	60S ribosome subunit biogenesis protein NIP7 homolog
16	9606.ENSP00000227474	0.915	tRNA pseudouridine(38/39) synthase
17	9606.ENSP00000402338	0.897	Ribosome production factor 2 homolog
18	9606.ENSP00000358812	0.889	Protein RRP5 homolog
19	9606.ENSP00000363746	0.874	WD repeat-containing protein 46
20	9606.ENSP00000415899	0.873	Pseudouridylate synthase that catalyzes pseudouridylation of RNAs

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0009982	1.000	pseudouridine synthase activity
GO:0003723	1.000	RNA binding
GO:0005515	0.860	protein binding
GO:0070883	0.718	pre-miRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006396	0.992	RNA processing
GO:0050789	0.985	regulation of biological process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0008033	0.976	tRNA processing
GO:0019219	0.974	regulation of nucleobase-containing compound metabolic process
GO:0006400	0.972	tRNA modification
GO:0016556	0.966	mRNA modification
GO:0031325	0.961	positive regulation of cellular metabolic process
GO:0001522	0.956	pseudouridine synthesis
GO:0051252	0.926	regulation of RNA metabolic process
GO:0010468	0.915	regulation of gene expression
GO:0060964	0.907	regulation of miRNA-mediated gene silencing
GO:0070920	0.784	regulation of production of small RNA involved in gene silencing by RNA
GO:0051173	0.674	positive regulation of nitrogen compound metabolic process
GO:0010628	0.383	positive regulation of gene expression
GO:0045935	0.383	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.351	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.997	cytosol
GO:0031981	0.966	nuclear lumen
GO:0005654	0.943	nucleoplasm
GO:0043232	0.372	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.4.-.-	1.000	Intramolecular transferases.

[back to server]