StarFunc result for job id Q8WWI1

User Input

>input (1683 residues)
MKKIRICHIFTFYSWMSYDVLFQRTELGALEIWRQLICAHVCICVGWLYLRDRVCSKKDI
ILRTEQNSGRTILIKAVTEKNFETKDFRASLENGVLLCDLINKLKPGVIKKINRLSTPIA
GLDNINVFLKACEQIGLKEAQLFHPGDLQDLSNRVTVKQEETDRRVKNVLITLYWLGRKA
QSNPYYNGPHLNLKAFENLLGQALTKALEDSSFLKRSGRDSGYGDIWCPERGEFLAPPRH
HKREDSFESLDSLGSRSLTSCSSDITLRGGREGFESDTDSEFTFKMQDYNKDDMSYRRIS
AVEPKTALPFNRFLPNKSRQPSYVPAPLRKKKPDKHEDNRRSWASPVYTEADGTFSSNQR
RIWGTNVENWPTVQGTSKSSCYLEEEKAKTRSIPNIVKDDLYVRKLSPVMPNPGNAFDQF
LPKCWTPEDVNWKRIKRETYKPWYKEFQGFSQFLLLQALQTYSDDILSSETHTKIDPTSG
PRLITRRKNLSYAPGYRRDDLEMAALDPDLENDDFFVRKTGVFHANPYVLRAFEDFRKFS
EQDDSVERDIILQCREGELVLPDLEKDDMIVRRIPAQKKEVPLSGAPDRYHPVPFPEPWT
LPPEIQAKFLCVFERTCPSKEKSNSCRILVPSYRQKKDDMLTRKIQSWKLGTTVPPISFT
PGPCSEADLKRWEAIREASRLRHKKRLMVERLFQKIYGENGSKSMSDVSAEDVQNLRQLR
YEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKT
FKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPS
EIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSPASLSSLRSRSTQMESTRVSASLPRSY
RKTDTVRLTSVVTPRPFGSQTRGISSLPRSYTMDDAWKYNGDVEDIKRTPNNVVSTPAPS
PDASQLASSLSSQKEVAATEEDVTRLPSPTSPFSSLSQDQAATSKATLSSTSGLDLMSES
GEGEISPQREVSRSQDQFSDMRISINQTPGKSLDFGFTIKWDIPGIFVASVEAGSPAEFS
QLQVDDEIIAINNTKFSYNDSKEWEEAMAKAQETGHLVMDVRRYGKAGSPETKWIDATSG
IYNSEKSSNLSVTTDFSESLQSSNIESKEINGIHDESNAFESKASESISLKNLKRRSQFF
EQGSSDSVVPDLPVPTISAPSRWVWDQEEERKRQERWQKEQDRLLQEKYQREQEKLREEW
QRAKQEAERENSKYLDEELMVLSSNSMSLTTREPSLATWEATWSEGSKSSDREGTRAGEE
ERRQPQEEVVHEDQGKKPQDQLVIERERKWEQQLQEEQEQKRLQAEAEEQKRPAEEQKRQ
AEIERETSVRIYQYRRPVDSYDIPKTEEASSGFLPGDRNKSRSTTELDDYSTNKNGNNKY
LDQIGNMTSSQRRSKKEQVPSGAELERQQILQEMRKRTPLHNDNSWIRQRSASVNKEPVS
LPGIMRRGESLDNLDSPRSNSWRQPPWLNQPTGFYASSSVQDFSRPPPQLVSTSNRAYMR
NPSSSVPPPSAGSVKTSTTGVATTQSPTPRSHSPSASQSGSQLRNRSVSGKRICSYCNNI
LGKGAAMIIESLGLCYHLHCFKCVACECDLGGSSSGAEVRIRNHQLYCNDCYLRFKSGRP
TAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K8R3	0.209	0.205	0.000	1729	0.769	0.749	A0A0G2K8R3.pdb.gz	A0A0G2K8R3_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=2
2	AFDB:E9PYF4	0.147	0.147	0.000	1699	0.775	0.768	E9PYF4.pdb.gz	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
3	AFDB:Q8WWI1	1.000	1.000	0.000	1683	1.000	1.000	Q8WWI1.pdb.gz	LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3
4	AFDB:F6NN15	0.187	0.214	1.277E-64	1384	0.288	0.350	F6NN15.pdb.gz	F6NN15_DANRE LIM domain 7b OS=Danio rerio OX=7955 GN=DKEY-180K21.1 PE=4 SV=2
5	AFDB:F1R7D1	0.135	0.182	1.293E-55	1173	0.263	0.378	F1R7D1.pdb.gz
6	AFDB:Q9UPQ0	0.087	0.131	8.868E-33	1083	0.214	0.332	Q9UPQ0.pdb.gz	LIMC1_HUMAN LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4
7	AFDB:E9Q9R9	0.048	0.042	5.813E-6	1921	0.086	0.075	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
8	AFDB:Q9W283	0.055	0.069	3.241E-5	1329	0.102	0.129	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
9	AFDB:Q9ULH7	0.032	0.044	8.581E-5	1088	0.102	0.157	Q9ULH7.pdb.gz	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3
10	PDB:6t36A	0.049	0.772	1.647E-4	93	0.012	0.226	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
11	PDB:7pc3A	0.046	0.177	2.920E-4	405	0.012	0.049	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7p73A	0.049	0.181	3.672E-4	420	0.011	0.045	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:2l4tA	0.050	0.534	3.888E-4	124	0.016	0.218	2l4tA.pdb.gz	Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
14	AFDB:Q7Z570	0.037	0.049	4.267E-4	1209	0.116	0.162	Q7Z570.pdb.gz	Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens OX=9606 GN=ZNF804A PE=2 SV=3
15	PDB:7qqmA	0.050	0.193	5.806E-4	413	0.012	0.051	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:2xkxA	0.044	0.099	1.030E-3	721	0.014	0.033	2xkxA.pdb.gz
17	PDB:7p70A	0.049	0.187	1.628E-3	407	0.011	0.047	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:4kfzB	0.035	0.373	1.724E-3	148	0.009	0.101	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
19	PDB:7pcbA	0.047	0.185	2.047E-3	415	0.008	0.034	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pe9I	0.044	0.213	2.047E-3	317	0.008	0.044	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K174	0.0	1074	1391	0.340	0.412	A0A0G2K174_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=2
2	A0A0G2K8R3	0.0	2344	1719	0.729	0.714	A0A0G2K8R3_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=2
3	A0A8I5ZR48	0.0	1192	1356	0.425	0.527	A0A8I5ZR48_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
4	A0A8I5ZWT3	0.0	1127	1395	0.352	0.424	A0A8I5ZWT3_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
5	A0A8I6AAI2	0.0	2283	1657	0.711	0.722	A0A8I6AAI2_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
6	A0A8I6AMI4	0.0	2323	1662	0.721	0.730	A0A8I6AMI4_RAT LIM domain 7 OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=1 SV=1
7	E9PYF4	0.0	2500	1699	0.769	0.762	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
8	Q6JBI7	0.0	2413	1729	0.746	0.726	Q6JBI7_RAT LMO7a OS=Rattus norvegicus OX=10116 GN=Lmo7 PE=2 SV=1
9	Q8WWI1	0.0	3476	1683	1.000	1.000	LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3
10	Q9UPQ0	8.42e-87	311	1083	0.093	0.145	LIMC1_HUMAN LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4
11	F6NN15	2.36e-85	310	1384	0.182	0.222	F6NN15_DANRE LIM domain 7b OS=Danio rerio OX=7955 GN=DKEY-180K21.1 PE=4 SV=2
12	Q8MNT0	2.60e-20	100	1099	0.026	0.039	Q8MNT0_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-8 PE=1 SV=1
13	Q95QI2	3.03e-20	100	868	0.026	0.050	Q95QI2_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-8 PE=1 SV=1
14	Q95QI3	4.68e-20	99.8	1004	0.026	0.043	Q95QI3_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-8 PE=1 SV=1
15	Q55GV9	9.65e-18	91.7	686	0.031	0.076	LIMCH_DICDI Calponin homology and LIM domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=ChLim PE=1 SV=1
16	Q55E26	3.84e-12	74.3	1198	0.024	0.033	GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum OX=44689 GN=gxcB PE=2 SV=1
17	Q9VZI1	5.23e-10	62.8	188	0.025	0.223	Q9VZI1_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=2
18	M9PE30	6.87e-10	62.0	175	0.025	0.240	M9PE30_DROME Transgelin OS=Drosophila melanogaster OX=7227 GN=Chd64 PE=1 SV=1
19	Q6PBA5	1.47e-09	63.5	307	0.020	0.107	Q6PBA5_DANRE Calponin OS=Danio rerio OX=7955 GN=wu:fb93a05 PE=1 SV=1
20	Q1HQ70	3.04e-08	57.8	188	0.023	0.207	Q1HQ70_BOMMO Transgelin OS=Bombyx mori OX=7091 GN=732906 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	1.1e+02	14.0	CAMSAP CH domain
2	PF00307 CH	1.1e-09	49.8	Calponin homology (CH) domain
3	PF12616 DUF3775	4.4e+02	12.3	Protein of unknown function (DUF3775)
4	PF15949 DUF4757	2.6e-42	156.4	Domain of unknown function (DUF4757)
5	PF00412 LIM	0.0017	29.8	LIM domain
6	PF00595 PDZ	0.00051	31.7	PDZ domain
7	PF13180 PDZ_2	0.34	22.7	PDZ domain
8	PF17820 PDZ_6	0.64	21.3	PDZ domain
9	PF02163 Peptidase_M50	4.9	17.9	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012289

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005783	0.879	Actinin, alpha 4
2	9593.ENSGGOP00000010031	0.735	Golgin B1
3	9593.ENSGGOP00000012753	0.733	LIM domain binding 3
4	9593.ENSGGOP00000017627	0.723	Amine oxidase
5	9593.ENSGGOP00000009171	0.715	Emerin
6	9593.ENSGGOP00000022818	0.663	Centromere protein F, 350/400kDa
7	9593.ENSGGOP00000018950	0.652	BCAR1, Cas family scaffolding protein
8	9593.ENSGGOP00000015301	0.649	Ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
9	9593.ENSGGOP00000014102	0.644	PDZ and LIM domain 7 (enigma)
10	9593.ENSGGOP00000001912	0.639	PDZ and LIM domain 3
11	9593.ENSGGOP00000003434	0.633	LIM domain kinase 2
12	9593.ENSGGOP00000024802	0.632	AHNAK nucleoprotein
13	9593.ENSGGOP00000023216	0.601	Uncharacterized protein
14	9593.ENSGGOP00000014897	0.591	Plasminogen activator, urokinase
15	9593.ENSGGOP00000007076	0.589	Erbb2 interacting protein
16	9593.ENSGGOP00000000899	0.585	Coiled-coil domain containing 22
17	9593.ENSGGOP00000007641	0.584	Calcium/calmodulin-dependent serine protein kinase (MAGUK family)
18	9593.ENSGGOP00000001800	0.577	BCL2-associated transcription factor 1
19	9593.ENSGGOP00000010162	0.574	PDZ and LIM domain 4
20	9593.ENSGGOP00000013661	0.574	VANGL planar cell polarity protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.998	cytoskeletal protein binding
GO:0042805	0.993	actinin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0010557	0.979	positive regulation of macromolecule biosynthetic process
GO:0031328	0.978	positive regulation of cellular biosynthetic process
GO:0045935	0.978	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0051254	0.938	positive regulation of RNA metabolic process
GO:1903508	0.933	positive regulation of nucleic acid-templated transcription
GO:0045893	0.875	positive regulation of DNA-templated transcription
GO:0045944	0.815	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0030054	0.998	cell junction
GO:0005634	0.994	nucleus
GO:0070161	0.989	anchoring junction
GO:0005829	0.987	cytosol
GO:0016020	0.980	membrane
GO:0012505	0.971	endomembrane system
GO:0005886	0.933	plasma membrane
GO:0098590	0.658	plasma membrane region
GO:0031975	0.657	envelope
GO:0070013	0.588	intracellular organelle lumen
GO:0031981	0.566	nuclear lumen
GO:0005911	0.559	cell-cell junction
GO:0031967	0.550	organelle envelope
GO:0005635	0.529	nuclear envelope
GO:0005925	0.491	focal adhesion
GO:0045177	0.490	apical part of cell
GO:0016324	0.460	apical plasma membrane
GO:0005912	0.407	adherens junction
GO:0043232	0.404	intracellular non-membrane-bounded organelle
GO:0005654	0.322	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]