StarFunc result for job id Q8WWK9

User Input

>input (683 residues)
MSTPAVPQDLQLPPSQRAQSAFKEQRRQKLKEHLLRRKTLFAYKQENEMLSSSRDQRVVT
SEDQVQEGTKVLKLKTKMADKENMKRPAESKNNTVVGKHCIPLKPSNELTNSTVVIDTHK
PKDSNQTPHLLLTEDDPQSQHMTLSQAFHLKNNSKKKQMTTEKQKQDANMPKKPVLGSYR
GQIVQSKINSFRKPLQVKDESSAATKKLSATIPKATKPQPVNTSSVTVKSNRSSNMTATT
KFVSTTSQNTQLVRPPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSV
KTSSSQGIIRNKTLSRSIASEVIARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQP
KETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFT
EKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENI
IAIYEKAILAGAQPIEEMRHTIVDILTMKSQEKANLGENMEKSCASKEEVKEVSIEDTGV
DVDPEKLEMESKLHRNLLFQDCEKEQDNKTKDPTHDVKTPNTETRTSCLIKYNVSTTPYL
QSVKKKVQFDGTNSAFKELKFLTPVRRSRRLQEKTSKLPDMLKDHYPCVSSLEQLTELGR
ETDAFVCRPNAALCRVYYEADTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWK9	1.000	1.000	7.673E-98	683	1.000	1.000	Q8WWK9.pdb.gz	CKAP2_HUMAN Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 PE=1 SV=1
2	AFDB:Q8IYA6	0.186	0.175	4.189E-18	745	0.202	0.185	Q8IYA6.pdb.gz	CKP2L_HUMAN Cytoskeleton-associated protein 2-like OS=Homo sapiens OX=9606 GN=CKAP2L PE=1 SV=4
3	AFDB:Q0DIQ5	0.060	0.037	4.819E-3	1510	0.123	0.056	Q0DIQ5.pdb.gz	CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF5 PE=1 SV=1
4	AFDB:Q9VGI8	0.062	0.039	2.275E-2	1487	0.138	0.063	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
5	PDB:6tljS	0.115	0.235	3.233E-2	293	0.035	0.082	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
6	AFDB:P09087	0.079	0.105	3.893E-2	493	0.098	0.136	P09087.pdb.gz	ABDB_DROME Homeobox protein abdominal-B OS=Drosophila melanogaster OX=7227 GN=Abd-B PE=1 SV=3
7	AFDB:Q9Y4F4	0.058	0.034	4.942E-2	1720	0.122	0.048	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
8	AFDB:P53890	0.076	0.105	7.071E-2	448	0.091	0.138	P53890.pdb.gz	BNI5_YEAST Bud neck protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNI5 PE=1 SV=1
9	AFDB:Q86SQ0	0.073	0.043	7.506E-2	1253	0.127	0.069	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
10	AFDB:Q06407	0.055	0.042	1.012E-1	1009	0.143	0.097	Q06407.pdb.gz	RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA2 PE=1 SV=1
11	AFDB:O14148	0.048	0.030	1.140E-1	1604	0.108	0.046	O14148.pdb.gz	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4
12	PDB:4cguA	0.108	0.511	1.276E-1	112	0.016	0.098	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
13	PDB:6iczJ	0.100	0.116	3.123E-1	571	0.034	0.040	6iczJ.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
14	PDB:5nrlJ	0.067	0.058	5.035E-1	800	0.041	0.035	5nrlJ.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:2c2lA	0.105	0.229	6.023E-1	281	0.020	0.050	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
16	PDB:5o9zG	0.087	0.075	6.023E-1	804	0.020	0.017	5o9zG.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
17	PDB:7mq8LT	0.077	0.064	6.393E-1	869	0.034	0.026	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:2fi7A	0.116	0.319	7.204E-1	223	0.022	0.067	2fi7A.pdb.gz
19	PDB:7kzqE	0.075	0.105	7.204E-1	419	0.040	0.064	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
20	PDB:2jmhA	0.051	0.188	8.117E-1	117	0.019	0.111	2jmhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3V1H1	0.0	724	664	0.602	0.619	CKAP2_MOUSE Cytoskeleton-associated protein 2 OS=Mus musculus OX=10090 GN=Ckap2 PE=1 SV=1
2	Q8WWK9	0.0	1408	683	1.000	1.000	CKAP2_HUMAN Cytoskeleton-associated protein 2 OS=Homo sapiens OX=9606 GN=CKAP2 PE=1 SV=1
3	Q8IYA6	1.48e-32	136	745	0.149	0.137	CKP2L_HUMAN Cytoskeleton-associated protein 2-like OS=Homo sapiens OX=9606 GN=CKAP2L PE=1 SV=4
4	O08604	2.4	33.1	253	0.064	0.174	RAE1C_MOUSE Retinoic acid early-inducible protein 1-gamma OS=Mus musculus OX=10090 GN=Raet1c PE=1 SV=1
5	P9WNL5	2.8	33.9	1094	0.031	0.019	EMBC_MYCTU Probable arabinosyltransferase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=embC PE=1 SV=1
6	F4KDA5	3.0	33.5	706	0.029	0.028	MIP_ARATH Mitochondrial intermediate peptidase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OCT1 PE=3 SV=1
7	Q9NVW2	3.5	33.5	624	0.047	0.051	RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens OX=9606 GN=RLIM PE=1 SV=3
8	Q55BN0	4.0	33.1	1662	0.032	0.013	MED23_DICDI Putative mediator of RNA polymerase II transcription subunit 23 OS=Dictyostelium discoideum OX=44689 GN=med23 PE=3 SV=1
9	Q4KCD4	4.1	33.5	4163	0.022	0.004	Q4KCD4_PSEF5 Polyketide synthase RzxE OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=rzxE PE=3 SV=1
10	E1C0W6	5.4	32.7	661	0.059	0.061	E1C0W6_CHICK protein-arginine deiminase OS=Gallus gallus OX=9031 GN=cPAD1 PE=2 SV=1
11	M9PB30	6.3	32.7	22949	0.079	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
12	M9PBZ0	6.9	32.7	22830	0.079	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PC41	6.9	32.7	22743	0.079	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PC45	6.9	32.7	22300	0.079	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PEH5	7.1	32.7	20710	0.079	0.003	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PEI1	7.4	32.3	21657	0.079	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	D0IMZ5	7.5	32.3	2255	0.025	0.008	D0IMZ5_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
18	D0IMZ7	7.8	32.3	2204	0.025	0.008	D0IMZ7_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
19	D0IMZ8	7.8	32.3	2206	0.025	0.008	D0IMZ8_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1
20	U4PBJ9	7.8	32.3	2259	0.025	0.008	U4PBJ9_CAEEL Calponin-homology (CH) domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fln-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15297 CKAP2_C	7.6e-189	638.7	Cytoskeleton-associated protein 2 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367276

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260731	0.973	Kinesin-like protein KIF11
2	9606.ENSP00000378699	0.968	Cyclin-dependent kinase 1
3	9606.ENSP00000247191	0.953	Disks large-associated protein 5
4	9606.ENSP00000274026	0.953	Cyclin-A2
5	9606.ENSP00000358813	0.953	Dual specificity protein kinase TTK
6	9606.ENSP00000411532	0.953	DNA topoisomerase 2-alpha
7	9606.ENSP00000453403	0.953	Nucleolar and spindle-associated protein 1
8	9606.ENSP00000261597	0.950	Kinetochore protein NDC80 homolog
9	9606.ENSP00000356379	0.949	Abnormal spindle-like microcephaly-associated protein
10	9606.ENSP00000265148	0.947	Centromere-associated protein E
11	9606.ENSP00000361540	0.943	Cell division cycle protein 20 homolog
12	9606.ENSP00000376457	0.936	Protein ECT2
13	9606.ENSP00000360540	0.935	Centrosomal protein of 55 kDa
14	9606.ENSP00000302530	0.933	Mitotic checkpoint serine/threonine-protein kinase BUB1
15	9606.ENSP00000362146	0.932	Borealin
16	9606.ENSP00000355922	0.930	Centromere protein F
17	9606.ENSP00000357643	0.920	Proliferation marker protein Ki-67
18	9606.ENSP00000377793	0.920	Protein regulator of cytokinesis 1
19	9606.ENSP00000287598	0.917	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
20	9606.ENSP00000378356	0.917	Kinesin-like protein KIF20A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.399	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0000278	0.985	mitotic cell cycle
GO:0022402	0.982	cell cycle process
GO:0019222	0.971	regulation of metabolic process
GO:0048522	0.965	positive regulation of cellular process
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0080090	0.962	regulation of primary metabolic process
GO:1903047	0.957	mitotic cell cycle process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0009893	0.918	positive regulation of metabolic process
GO:0019219	0.799	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.752	positive regulation of cellular metabolic process
GO:0051301	0.736	cell division
GO:0010556	0.715	regulation of macromolecule biosynthetic process
GO:0031326	0.715	regulation of cellular biosynthetic process
GO:0010604	0.691	positive regulation of macromolecule metabolic process
GO:0051173	0.649	positive regulation of nitrogen compound metabolic process
GO:2001141	0.566	regulation of RNA biosynthetic process
GO:0010468	0.459	regulation of gene expression
GO:0006355	0.449	regulation of DNA-templated transcription
GO:0000281	0.437	mitotic cytokinesis
GO:0051128	0.374	regulation of cellular component organization
GO:0045935	0.343	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.338	positive regulation of macromolecule biosynthetic process
GO:0031328	0.338	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005819	0.999	spindle
GO:0005813	0.997	centrosome
GO:0072686	0.984	mitotic spindle
GO:0005829	0.943	cytosol
GO:0043227	0.768	membrane-bounded organelle
GO:0043231	0.706	intracellular membrane-bounded organelle
GO:0005634	0.505	nucleus
GO:0031981	0.493	nuclear lumen
GO:0005654	0.470	nucleoplasm
GO:0099080	0.301	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]