StarFunc result for job id Q8WWL7

User Input

>input (1395 residues)
MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESPSSLQGALKKR
SAFEDLTNASQCQPVQPKKEANKEFVKVVSKKINRNTHALGLAKKNKRNLKWHKLEVTPV
VASTTVVPNIMEKPLILDISTTSKTPNTEEASLFRKPLVLKEEPTIEDETLINKSLSLKK
CSNHEEVSLLEKLQPLQEESDSDDAFVIEPMTFKKTHKTEEAAITKKTLSLKKKMCASQR
KQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPTHKLSSLKKKCTIYGKICHFR
KPPVLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHTTEHEMSILKKSLALQKTNFKED
SLVKESLAFKKKPSTEEAIMMPVILKEQCMTEGKRSRLKPLVLQEITSGEKSLIMKPLSI
KEKPSTEKESFSQEPSALQKKHTTQEEVSILKEPSSLLKSPTEESPFDEALAFTKKCTIE
EAPPTKKPLILKRKHATQGTMSHLKKPLILQTTSGEKSLIKEPLPFKEEKVSLKKKCTTQ
EMMSICPELLDFQDMIGEDKNSFFMEPMSFRKNPTTEETVLTKTSLSLQEKKITQGKMSH
LKKPLVLQKITSEEESFYKKLLPFKMKSTTEEKFLSQEPSALKEKHTTLQEVSLSKESLA
IQEKATTEEEFSQELFSLHVKHTNKSGSLFQEALVLQEKTDAEEDSLKNLLALQEKSTME
EESLINKLLALKEELSAEAATNIQTQLSLKKKSTSHGKVFFLKKQLALNETINEEEFLNK
QPLALEGYPSIAEGETLFKKLLAMQEEPSIEKEAVLKEPTIDTEAHFKEPLALQEEPSTE
KEAVLKEPSVDTEAHFKETLALQEKPSIEQEALFKRHSALWEKPSTEKETIFKESLDLQE
KPSIKKETLLKKPLALKMSTINEAVLFEDMIALNEKPTTGKELSFKEPLALQESPTYKED
TFLKTLLVPQVGTSPNVSSTAPESITSKSSIATMTSVGKSGTINEAFLFEDMITLNEKPT
TGKELSFKEPLALQESPTCKEDTFLETFLIPQIGTSPYVFSTTPESITEKSSIATMTSVG
KSRTTTESSACESASDKPVSPQAKGTPKEITPREDIDEDSSDPSFNPMYAKEIFSYMKER
EEQFILTDYMNRQIEITSDMRAILVDWLVEVQVSFEMTHETLYLAVKLVDLYLMKAVCKK
DKLQLLGATAFMIAAKFEEHNSPRVDDFVYICDDNYQRSEVLSMEINILNVLKCDINIPI
AYHFLRRYARCIHTNMKTLTLSRYICEMTLQEYHYVQEKASKLAAASLLLALYMKKLGYW
VPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKL
EEILNCDCEAQGLVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWL7	1.000	1.000	0.000	1395	1.000	1.000	Q8WWL7.pdb.gz	CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens OX=9606 GN=CCNB3 PE=1 SV=2
2	PDB:7nj0C	0.183	0.905	9.819E-17	270	0.062	0.319	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
3	PDB:7b5lY	0.173	0.927	1.398E-14	253	0.063	0.348	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
4	PDB:2w96A	0.135	0.687	2.845E-9	249	0.039	0.221	2w96A.pdb.gz
5	PDB:3g33B	0.153	0.892	4.590E-9	229	0.037	0.223	3g33B.pdb.gz
6	PDB:1g3nC	0.146	0.816	2.014E-8	233	0.034	0.202	1g3nC.pdb.gz
7	PDB:6gzhB	0.132	0.648	6.575E-5	252	0.022	0.119	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
8	PDB:5hbhB	0.134	0.627	1.108E-4	270	0.023	0.119	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
9	PDB:1zp2A	0.114	0.607	3.013E-4	227	0.031	0.189	1zp2A.pdb.gz
10	PDB:7jv7B	0.145	0.569	3.287E-4	310	0.024	0.110	7jv7B.pdb.gz
11	PDB:7zs9M	0.073	0.278	7.193E-4	310	0.019	0.084	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
12	AFDB:Q9W517	0.070	0.062	7.739E-3	1741	0.135	0.109	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
13	AFDB:Q12774	0.052	0.048	2.732E-2	1597	0.146	0.127	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
14	AFDB:E5FYH1	0.072	0.064	4.605E-2	1653	0.154	0.130	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
15	AFDB:Q80XI3	0.059	0.054	7.761E-2	1579	0.101	0.089	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
16	AFDB:A8DZ29	0.055	0.047	8.106E-2	1919	0.121	0.088	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
17	AFDB:A0A0R4IZ84	0.060	0.057	9.647E-2	1544	0.098	0.089	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
18	AFDB:Q96PE2	0.050	0.038	1.199E-1	2063	0.130	0.088	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
19	AFDB:Q0DIQ5	0.054	0.051	2.862E-1	1510	0.140	0.129	Q0DIQ5.pdb.gz	CWZF5_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF5 PE=1 SV=1
20	AFDB:Q920R4	0.058	0.057	3.122E-1	1346	0.146	0.151	Q920R4.pdb.gz	GASP1_RAT G-protein coupled receptor-associated sorting protein 1 OS=Rattus norvegicus OX=10116 GN=Gprasp1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WWL7	0.0	2795	1395	1.000	1.000	CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens OX=9606 GN=CCNB3 PE=1 SV=2
2	Q9I7I0	1.36e-74	262	575	0.094	0.228	CCNB3_DROME G2/mitotic-specific cyclin-B3 OS=Drosophila melanogaster OX=7227 GN=CycB3 PE=1 SV=1
3	Q10654	2.69e-63	223	385	0.092	0.332	CCNB3_CAEEL G2/mitotic-specific cyclin-B3 OS=Caenorhabditis elegans OX=6239 GN=cyb-3 PE=2 SV=3
4	P42524	5.74e-49	183	436	0.075	0.241	CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum OX=44689 GN=cycB PE=1 SV=1
5	E9PC90	5.47e-48	179	401	0.061	0.212	E9PC90_HUMAN G2/mitotic-specific cyclin-B1 (Fragment) OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1
6	P14635	9.18e-48	179	433	0.061	0.196	CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1
7	P24860	1.62e-47	178	430	0.059	0.193	CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus OX=10090 GN=Ccnb1 PE=1 SV=3
8	P13350	3.42e-47	176	397	0.061	0.214	CCNB1_XENLA G2/mitotic-specific cyclin-B1 OS=Xenopus laevis OX=8355 GN=ccnb1 PE=1 SV=1
9	P13351	8.15e-47	175	392	0.070	0.250	CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis OX=8355 GN=ccnb2 PE=1 SV=1
10	P30277	4.25e-46	174	423	0.058	0.191	CCNB1_RAT G2/mitotic-specific cyclin-B1 OS=Rattus norvegicus OX=10116 GN=Ccnb1 PE=2 SV=1
11	P20439	1.36e-45	175	530	0.070	0.185	CCNB_DROME G2/mitotic-specific cyclin-B OS=Drosophila melanogaster OX=7227 GN=CycB PE=1 SV=2
12	Q9IB44	2.16e-45	171	398	0.062	0.219	Q9IB44_DANRE G2/mitotic-specific cyclin-B1 OS=Danio rerio OX=7955 GN=wu:fb16d01 PE=1 SV=1
13	Q9C6Y3	6.07e-45	172	460	0.072	0.220	CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA1-1 PE=1 SV=1
14	D2IE28	9.01e-45	171	435	0.059	0.191	D2IE28_PIG G2/mitotic-specific cyclin-B1 OS=Sus scrofa OX=9823 GN=CCNB1 PE=2 SV=1
15	A9ZPH4	6.57e-44	167	396	0.067	0.237	A9ZPH4_PIG Cyclin B2 OS=Sus scrofa OX=9823 GN=CCNB2 PE=2 SV=1
16	Q147G5	1.23e-43	167	436	0.070	0.225	CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-2 PE=2 SV=1
17	Q38819	1.51e-43	167	450	0.077	0.238	CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-3 PE=1 SV=2
18	O48790	1.54e-43	166	387	0.078	0.282	CCB14_ARATH Cyclin-B1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-4 PE=2 SV=1
19	P30276	2.36e-43	165	398	0.070	0.246	CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus OX=10090 GN=Ccnb2 PE=1 SV=2
20	P29332	3.12e-43	165	399	0.064	0.223	CCNB2_CHICK G2/mitotic-specific cyclin-B2 OS=Gallus gallus OX=9031 GN=CCNB2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	3.3e-20	83.7	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	3.5e-36	135.2	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365210

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
2	9606.ENSP00000300093	0.991	Serine/threonine-protein kinase PLK1
3	9606.ENSP00000266970	0.990	Cyclin-dependent kinase 2
4	9606.ENSP00000256442	0.979	G2/mitotic-specific cyclin-B1
5	9606.ENSP00000288207	0.979	G2/mitotic-specific cyclin-B2
6	9606.ENSP00000361540	0.966	Cell division cycle protein 20 homolog
7	9606.ENSP00000307288	0.939	DNA replication licensing factor MCM7
8	9606.ENSP00000368458	0.935	Proliferating cell nuclear antigen
9	9606.ENSP00000378529	0.918	Fizzy-related protein homolog
10	9606.ENSP00000296509	0.917	Mitotic spindle assembly checkpoint protein MAD2A
11	9606.ENSP00000453403	0.910	Nucleolar and spindle-associated protein 1
12	9606.ENSP00000260731	0.906	Kinesin-like protein KIF11
13	9606.ENSP00000303706	0.904	M-phase inducer phosphatase 1
14	9606.ENSP00000260363	0.902	Kinesin-like protein KIF23
15	9606.ENSP00000262105	0.882	DNA replication licensing factor MCM4
16	9606.ENSP00000216122	0.876	DNA replication licensing factor MCM5
17	9606.ENSP00000356379	0.872	Abnormal spindle-like microcephaly-associated protein
18	9606.ENSP00000311083	0.871	Cyclin-dependent kinases regulatory subunit 1
19	9606.ENSP00000264156	0.863	DNA replication licensing factor MCM6
20	9606.ENSP00000365107	0.863	Serine/threonine-protein kinase greatwall

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.976	regulation of cellular process
GO:0007049	0.511	cell cycle
GO:0019222	0.469	regulation of metabolic process
GO:0048519	0.373	negative regulation of biological process
GO:0008152	0.357	metabolic process
GO:0031323	0.332	regulation of cellular metabolic process
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.987	nuclear body
GO:0016607	0.982	nuclear speck
GO:0005829	0.954	cytosol
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0032991	0.569	protein-containing complex
GO:0016020	0.390	membrane
GO:0012505	0.312	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]