StarFunc result for job id Q8WWM7

User Input

>input (1075 residues)
MLKPQPLQQPSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLATSAAPPGPPAAASPCLG
PVAAAGSGLRRGAEGILAPQPPPPQQHQERPGAAAIGSARGQSTGKGPPQSPVFEGVYNN
SRMLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIV
DTMVFKPSDVMLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDD
YDLESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLA
REIESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLASREGKYIPLPQRVREGP
RGGVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGAK
TLSSPSNRPSGETSVPPPPAVGRMYPPRSPKSAAPAPISASCPEPPIGSAVPTSSASIPV
TSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRF
QLEELRKFGAQFKLQPSSSPENSLDPFPPRILKEEPKGKEKEVDGLLTSEPMGSPVSSKT
ESVSDKEDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIKGEDKDEGPVAEQVKKSTLN
PNAKEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQIHMG
PAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAGPPLVA
ATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTP
QYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQ
APHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNM
AHVTQAHVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSP
YPYIGHPQGEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWM7	0.999	0.999	0.000	1075	1.000	1.000	Q8WWM7.pdb.gz	ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2
2	AFDB:F8WB06	0.139	0.137	5.240E-51	1087	0.392	0.387	F8WB06.pdb.gz	F8WB06_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=3
3	AFDB:O70305	0.202	0.174	1.166E-49	1285	0.408	0.342	O70305.pdb.gz	ATX2_MOUSE Ataxin-2 OS=Mus musculus OX=10090 GN=Atxn2 PE=1 SV=1
4	AFDB:Q99700	0.193	0.166	4.857E-49	1313	0.418	0.342	Q99700.pdb.gz	ATX2_HUMAN Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
5	AFDB:Q8SWR8	0.107	0.107	5.239E-24	1084	0.215	0.213	Q8SWR8.pdb.gz	ATX2_DROME Ataxin-2 homolog OS=Drosophila melanogaster OX=7227 GN=Atx2 PE=1 SV=1
6	AFDB:Q9USW1	0.080	0.098	8.143E-7	791	0.143	0.195	Q9USW1.pdb.gz	ATH1_SCHPO Ataxin-2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ath1 PE=1 SV=1
7	PDB:4c92B	0.066	0.581	1.851E-5	105	0.016	0.162	4c92B.pdb.gz
8	PDB:5nrll	0.065	0.591	2.686E-5	99	0.011	0.121	5nrll.pdb.gz	Structure of a pre-catalytic spliceosome.
9	PDB:6g90d	0.060	0.593	3.663E-5	93	0.013	0.151	6g90d.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
10	PDB:6ppqG	0.059	0.648	3.663E-5	85	0.012	0.153	6ppqG.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
11	PDB:6v4xG	0.060	0.730	3.663E-5	77	0.009	0.130	6v4xG.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
12	PDB:3jb9E	0.063	0.567	4.147E-5	98	0.009	0.102	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
13	PDB:3pgwF	0.061	0.669	4.147E-5	85	0.010	0.129	3pgwF.pdb.gz
14	PDB:6qw666	0.060	0.750	5.316E-5	72	0.010	0.153	6qw666.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:5vsuF	0.063	0.726	6.018E-5	77	0.011	0.156	5vsuF.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
16	PDB:7b9vq	0.058	0.725	6.018E-5	75	0.013	0.187	7b9vq.pdb.gz	Structural basis for conformational equilibrium of the catalytic spliceosome.
17	AFDB:A0A2R8YDD6	0.037	0.043	7.976E-4	892	0.149	0.179	A0A2R8YDD6.pdb.gz	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
18	AFDB:Q8R4I1	0.041	0.048	8.487E-4	867	0.146	0.181	Q8R4I1.pdb.gz	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
19	AFDB:Q70IV5	0.044	0.034	9.030E-4	1561	0.157	0.108	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
20	AFDB:Q86UU0	0.044	0.034	3.123E-3	1499	0.192	0.137	Q86UU0.pdb.gz	BCL9L_HUMAN B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGL7	0.0	774	401	0.372	0.998	A0A0C4DGL7_HUMAN Ataxin 2 like (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=1
2	H3BUF6	0.0	2069	1068	0.973	0.979	H3BUF6_HUMAN Ataxin 2 like OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=1
3	Q8WWM7	0.0	2137	1075	1.000	1.000	ATX2L_HUMAN Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2
4	A0A5F9ZHH4	5.06e-180	556	1065	0.401	0.405	A0A5F9ZHH4_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
5	A0A5F9ZI57	3.40e-145	466	1155	0.392	0.365	A0A5F9ZI57_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
6	V9GY86	3.57e-145	466	1153	0.390	0.363	V9GY86_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
7	A0A2R8Y5A6	2.21e-143	462	1166	0.390	0.359	A0A2R8Y5A6_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
8	F8VQP2	1.65e-134	436	1073	0.385	0.386	F8VQP2_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
9	A0A5F9ZHW5	1.64e-122	406	1178	0.380	0.346	A0A5F9ZHW5_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
10	F8WB06	8.57e-105	355	1087	0.160	0.158	F8WB06_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=3
11	A0A5F9ZHX3	1.29e-103	354	1167	0.159	0.147	A0A5F9ZHX3_HUMAN Ataxin 2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
12	Q99700	5.56e-103	354	1313	0.160	0.131	ATX2_HUMAN Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
13	O70305	7.53e-95	331	1285	0.165	0.138	ATX2_MOUSE Ataxin-2 OS=Mus musculus OX=10090 GN=Atxn2 PE=1 SV=1
14	F8W0B5	7.63e-65	239	908	0.113	0.134	F8W0B5_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=4
15	Q8SWR8	1.29e-37	155	1084	0.086	0.085	ATX2_DROME Ataxin-2 homolog OS=Drosophila melanogaster OX=7227 GN=Atx2 PE=1 SV=1
16	F8WB05	1.10e-34	140	424	0.148	0.375	F8WB05_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=2
17	A0A2R8YGV1	2.46e-22	99.8	255	0.100	0.424	A0A2R8YGV1_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
18	A0A2R8YCG6	4.04e-22	100	298	0.113	0.409	A0A2R8YCG6_HUMAN Ataxin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ATXN2 PE=1 SV=1
19	G5ED29	4.96e-15	82.4	959	0.060	0.068	ATX2_CAEEL Ataxin-2 homolog OS=Caenorhabditis elegans OX=6239 GN=atx-2 PE=1 SV=1
20	D4PH96	2.01e-14	80.9	1070	0.060	0.061	D4PH96_CAEEL LsmAD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atx-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12701 LSM14	3.2e+02	12.8	Scd6-like Sm domain
2	PF06741 LsmAD	9e-14	63.1	LsmAD domain
3	PF07145 PAM2	0.033	24.9	Ataxin-2 C-terminal region
4	PF14438 SM-ATX	1e-15	69.0	Ataxin 2 SM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378917

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478754	0.980	Probable ATP-dependent RNA helicase DDX6
2	9606.ENSP00000466718	0.970	LSM12 homolog
3	9606.ENSP00000313007	0.942	Polyadenylate-binding protein 1
4	9606.ENSP00000366843	0.910	Ataxin-2
5	9606.ENSP00000352738	0.902	Ras GTPase-activating protein-binding protein 2
6	9606.ENSP00000361949	0.884	Polyadenylate-binding protein 4
7	9606.ENSP00000377681	0.884	Ras GTPase-activating protein-binding protein 1
8	9606.ENSP00000225388	0.881	Nuclear fragile X mental retardation-interacting protein 2
9	9606.ENSP00000478320	0.873	Ataxin-3
10	9606.ENSP00000281589	0.870	Polyadenylate-binding protein 3
11	9606.ENSP00000369996	0.865	Ataxin-3-like protein
12	9606.ENSP00000446271	0.803	Protein LSM14 homolog A
13	9606.ENSP00000222139	0.780	Erythropoietin receptor
14	9606.ENSP00000324792	0.761	NFATC2-interacting protein
15	9606.ENSP00000351811	0.724	Enhancer of mRNA-decapping protein 4
16	9606.ENSP00000369238	0.720	Disintegrin and metalloproteinase domain-containing protein 32
17	9606.ENSP00000359506	0.712	Synaptic functional regulator FMR1
18	9606.ENSP00000408005	0.679	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
19	9606.ENSP00000363435	0.678	Inositol 1,4,5-trisphosphate receptor type 3
20	9606.ENSP00000350170	0.673	Fragile X mental retardation syndrome-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0016070	0.979	RNA metabolic process
GO:0016071	0.945	mRNA metabolic process
GO:0050789	0.302	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0005634	0.927	nucleus
GO:0016020	0.878	membrane
GO:0070013	0.865	intracellular organelle lumen
GO:0031981	0.814	nuclear lumen
GO:0005654	0.783	nucleoplasm
GO:0010494	0.708	cytoplasmic stress granule
GO:0016607	0.367	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]