StarFunc result for job id Q8WWN8

User Input

>input (1544 residues)
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPAL
GGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSS
QISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQGRAEHRLSRQDLE
AREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFSFTADRLTPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFR
TESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRL
GLFRKPHPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEAFEGEEPWFPPAPDGSCPGL
LPSDPSPGVYNEVVVRATYSGFLYCSPVSNKAGPSPPRRGRDAPPRLWCVLGAALEMFAS
ENSPEPLSLIQPQDIVCLGVSPPPTDPGDRFPFSFELILAGGRIQHFGTDGADSLEAWTS
AVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSAPGP
GPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAAIGG
AAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRD
ARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVI
GCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQEL
IDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSP
TLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEPCS
ASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLK
EKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSI
LKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLS
MFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLT
SQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETT
AGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LH27	0.414	0.391	0.000	1664	0.489	0.454	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
2	AFDB:Q8R5G7	0.389	0.390	0.000	1538	0.883	0.887	Q8R5G7.pdb.gz	ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arap3 PE=1 SV=3
3	AFDB:Q8WWN8	0.999	0.999	0.000	1544	1.000	1.000	Q8WWN8.pdb.gz	ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3 PE=1 SV=1
4	AFDB:F1LM60	0.312	0.332	2.605E-99	1443	0.328	0.351	F1LM60.pdb.gz	F1LM60_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
5	AFDB:Q96P48	0.358	0.378	1.212E-98	1450	0.326	0.348	Q96P48.pdb.gz	ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3
6	PDB:5jcpA	0.128	0.544	1.674E-24	361	0.128	0.548	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
7	AFDB:F8VQB6	0.110	0.089	3.480E-15	2062	0.076	0.057	F8VQB6.pdb.gz	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
8	AFDB:P34288	0.114	0.110	1.980E-13	1605	0.150	0.144	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
9	AFDB:Q6DFV3	0.117	0.094	2.258E-13	1944	0.135	0.108	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
10	PDB:3ljuX	0.073	0.291	5.567E-13	373	0.054	0.223	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
11	AFDB:Q7Z5H3	0.127	0.265	1.155E-10	698	0.084	0.185	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
12	AFDB:X2JC00	0.120	0.130	1.957E-10	1404	0.099	0.109	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
13	PDB:3cxlA	0.107	0.401	3.418E-8	402	0.030	0.114	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
14	PDB:5c2kA	0.112	0.431	1.277E-7	382	0.036	0.144	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:6r3vA	0.105	0.765	3.828E-7	198	0.023	0.182	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
16	PDB:1xa6A	0.107	0.402	1.148E-6	399	0.031	0.120	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
17	PDB:3lvqE	0.078	0.268	2.887E-6	420	0.028	0.102	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
18	PDB:6hhgA	0.064	0.217	5.146E-4	386	0.033	0.132	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	PDB:4mk0A	0.066	0.155	7.641E-4	631	0.012	0.029	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:6bbpA	0.056	0.162	9.944E-4	520	0.016	0.048	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140LH27	0.0	1354	1664	0.446	0.414	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
2	A0A8I6AQA1	0.0	728	1454	0.278	0.296	A0A8I6AQA1_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
3	E7EU13	0.0	734	1194	0.280	0.362	E7EU13_HUMAN ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=1
4	F1LM60	0.0	735	1443	0.278	0.298	F1LM60_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
5	Q8R5G7	0.0	2603	1538	0.879	0.882	ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arap3 PE=1 SV=3
6	Q8WWN8	0.0	3134	1544	1.000	1.000	ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3 PE=1 SV=1
7	Q8WZ64	0.0	885	1704	0.308	0.279	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
8	Q96P48	0.0	726	1450	0.280	0.298	ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3
9	Q9VX92	1.11e-37	157	1552	0.095	0.094	Q9VX92_DROME Rho GTPase activating protein at 15B, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=1 SV=3
10	Q0KHR5	1.38e-37	157	1510	0.095	0.097	Q0KHR5_DROME Rho GTPase activating protein at 15B, isoform B OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=1 SV=1
11	Q8T3K2	1.47e-37	157	1226	0.094	0.118	Q8T3K2_DROME SD08167p OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=2 SV=1
12	H2KZV4	1.59e-30	133	1003	0.074	0.115	H2KZV4_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F23H11.4 PE=1 SV=1
13	Q9XX14	7.58e-21	102	1107	0.045	0.063	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
14	Q5W7F2	1.88e-19	97.4	827	0.033	0.062	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
15	A0JMI1	2.92e-19	97.1	827	0.037	0.069	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
16	Q9FL69	6.16e-19	94.4	483	0.028	0.089	AGD5_ARATH ADP-ribosylation factor GTPase-activating protein AGD5 OS=Arabidopsis thaliana OX=3702 GN=AGD5 PE=1 SV=1
17	O14559	2.31e-18	94.4	1287	0.040	0.048	RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens OX=9606 GN=ARHGAP33 PE=1 SV=2
18	Q8LFN9	2.61e-18	90.5	336	0.034	0.158	AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana OX=3702 GN=AGD13 PE=2 SV=1
19	Q9FIT8	3.45e-18	93.6	828	0.030	0.056	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
20	D4A9G6	3.70e-18	93.6	1354	0.041	0.047	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	7.8e-27	105.1	Putative GTPase activating protein for Arf
2	PF00169 PH	2.1e-32	123.1	PH domain
3	PF15413 PH_11	0.41	22.5	Pleckstrin homology domain
4	PF16652 PH_13	5.9e+02	11.8	Pleckstrin homology domain
5	PF08458 PH_2	2.5	19.8	Plant pleckstrin homology-like region
6	PF14593 PH_3	0.017	26.5	PH domain
7	PF15406 PH_6	0.028	26.1	Pleckstrin homology domain
8	PF15409 PH_8	0.00093	30.8	Pleckstrin homology domain
9	PF05373 Pro_3_hydrox_C	3.6e+02	12.7	L-proline 3-hydroxylase, C-terminal
10	PF00788 RA	8.7e-09	47.2	Ras association (RalGDS/AF-6) domain
11	PF00620 RhoGAP	2.5e-34	129.8	RhoGAP domain
12	PF00536 SAM_1	2.6e-06	39.1	SAM domain (Sterile alpha motif)
13	PF07647 SAM_2	2.9e-08	45.0	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000239440

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.982	Transforming protein RhoA
2	9606.ENSP00000298316	0.967	ADP-ribosylation factor 6
3	9606.ENSP00000298229	0.946	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
4	9606.ENSP00000358723	0.936	Ras-related protein Rap-1A
5	9606.ENSP00000250559	0.887	Ras-related protein Rap-1b
6	9606.ENSP00000380921	0.867	SH3 domain-containing kinase-binding protein 1
7	9606.ENSP00000376035	0.677	Zinc finger and BTB domain-containing protein 32
8	9606.ENSP00000249636	0.654	E3 SUMO-protein ligase PIAS1
9	9606.ENSP00000379287	0.647	14-3-3 protein zeta/delta
10	9606.ENSP00000463375	0.637	Transmembrane protein 200C
11	9606.ENSP00000421922	0.602	Alpha-2-macroglobulin receptor-associated protein
12	9606.ENSP00000381698	0.570	Sharpin
13	9606.ENSP00000299213	0.566	La-related protein 6
14	9606.ENSP00000450857	0.555	Stonin-2
15	9606.ENSP00000372750	0.552	Muscarinic acetylcholine receptor M5
16	9606.ENSP00000343435	0.548	Protein YIF1B
17	9606.ENSP00000245932	0.512	Vasodilator-stimulated phosphoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0005547	0.999	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0043325	0.986	phosphatidylinositol-3,4-bisphosphate binding
GO:0019899	0.364	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051179	0.956	localization
GO:0051234	0.930	establishment of localization
GO:0071840	0.921	cellular component organization or biogenesis
GO:0016043	0.912	cellular component organization
GO:0007010	0.893	cytoskeleton organization
GO:0050794	0.801	regulation of cellular process
GO:0006810	0.729	transport
GO:0016192	0.714	vesicle-mediated transport
GO:0048518	0.379	positive regulation of biological process
GO:0023051	0.373	regulation of signaling
GO:0051128	0.324	regulation of cellular component organization
GO:0048583	0.312	regulation of response to stimulus
GO:0009966	0.300	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0005886	0.999	plasma membrane
GO:0005829	0.981	cytosol
GO:0031982	0.783	vesicle
GO:0005794	0.741	Golgi apparatus
GO:0097708	0.725	intracellular vesicle
GO:0031410	0.717	cytoplasmic vesicle
GO:0005634	0.636	nucleus
GO:0031974	0.596	membrane-enclosed lumen
GO:0070013	0.592	intracellular organelle lumen
GO:0031981	0.492	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]