StarFunc result for job id Q8WWQ0

User Input

>input (1821 residues)
MSCERKGLSELRSELYFLIARFLEDGPCQQAAQVLIREVAEKELLPRRTDWTGKEHPRTY
QNLVKYYRHLAPDHLLQICHRLGPLLEQEIPQSVPGVQTLLGAGRQSLLRTNKSCKHVVW
KGSALAALHCGRPPESPVNYGSPPSIADTLFSRKLNGKYRLERLVPTAVYQHMKMHKRIL
GHLSSVYCVTFDRTGRRIFTGSDDCLVKIWATDDGRLLATLRGHAAEISDMAVNYENTMI
AAGSCDKMIRVWCLRTCAPLAVLQGHSASITSLQFSPLCSGSKRYLSSTGADGTICFWLW
DAGTLKINPRPAKFTERPRPGVQMICSSFSAGGMFLATGSTDHIIRVYFFGSGQPEKISE
LEFHTDKVDSIQFSNTSNRFVSGSRDGTARIWQFKRREWKSILLDMATRPAGQNLQGIED
KITKMKVTMVAWDRHDNTVITAVNNMTLKVWNSYTGQLIHVLMGHEDEVFVLEPHPFDPR
VLFSAGHDGNVIVWDLARGVKIRSYFNMIEGQGHGAVFDCKCSPDGQHFACTDSHGHLLI
FGFGSSSKYDKIADQMFFHSDYRPLIRDANNFVLDEQTQQAPHLMPPPFLVDVDGNPHPS
RYQRLVPGRENCREEQLIPQMGVTSSGLNQVLSQQANQEISPLDSMIQRLQQEQDLRRSG
EAVISNTSRLSRGSISSTSEVHSPPNVGLRRSGQIEGVRQMHSNAPRSEIATERDLVAWS
RRVVVPELSAGVASRQEEWRTAKGEEEIKTYRSEEKRKHLTVPKENKIPTVSKNHAHEHF
LDLGESKKQQTNQHNYRTRSALEETPRPSEEIENGSSSSDEGEVVAVSGGTSEEEERAWH
SDGSSSDYSSDYSDWTADAGINLQPPKKVPKNKTKKAESSSDEEEESEKQKQKQIKKEKK
KVNEEKDGPISPKKKKPKERKQKRLAVGELTENGLTLEEWLPSTWITDTIPRRCPFVPQM
GDEVYYFRQGHEAYVEMARKNKIYSINPKKQPWHKMELREQELMKIVGIKYEVGLPTLCC
LKLAFLDPDTGKLTGGSFTMKYHDMPDVIDFLVLRQQFDDAKYRRWNIGDRFRSVIDDAW
WFGTIESQEPLQLEYPDSLFQCYNVCWDNGDTEKMSPWDMELIPNNAVFPEELGTSVPLT
DGECRSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMYCTVV
AYPTDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFI
KDQTCYNIIPLYNSMKKKVLSDSEDEEKDADVPGTSTRKRKDHQPRRRLRNRAQSYDIQA
WKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPME
LCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTITKR
RKKRNRSSSVSSSAASSPERKKRILKPQLKSESSTSAFSTPTRSIPPRHNAAQINGKTES
SSVVRTRSNRVVVDPVVTEQPSTSSAAKTFITKANASAIPGKTILENSVKHSKALNTLSS
PGQSSFSHGTRNNSAKENMEKEKPVKRKMKSSVLPKASTLSKSSAVIEQGDCKNNALVPG
TIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVH
PIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLRR
SNRKKIDDPIDEEEEFEELKGSEPHMRTRNQGRRTAFYNEDDSEEEQRQLLFEDTSLTFG
TSSRGRVRKLTEKAKANLIGW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6RI45	0.434	0.438	0.000	1802	0.546	0.552	Q6RI45.pdb.gz	BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BRWD3 PE=1 SV=2
2	AFDB:Q8VDD9	0.441	0.441	0.000	1821	0.947	0.947	Q8VDD9.pdb.gz	PHIP_MOUSE PH-interacting protein OS=Mus musculus OX=10090 GN=Phip PE=1 SV=2
3	AFDB:Q921C3	0.313	0.249	0.000	2304	0.517	0.409	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
4	AFDB:Q9NSI6	0.340	0.272	0.000	2320	0.515	0.404	Q9NSI6.pdb.gz	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
5	AFDB:Q9VC96	0.283	0.233	0.000	2232	0.378	0.308	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
6	PDB:5mzhB	0.178	0.732	9.145E-23	415	0.055	0.243	5mzhB.pdb.gz
7	PDB:5nnzA	0.175	0.891	3.292E-22	335	0.048	0.263	5nnzA.pdb.gz
8	PDB:7bt6x	0.180	0.639	5.945E-22	488	0.053	0.199	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
9	PDB:5jcsq	0.177	0.637	4.480E-21	488	0.051	0.191	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
10	PDB:4v7fq	0.173	0.674	2.194E-19	443	0.048	0.199	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
11	PDB:2h9lA	0.141	0.691	5.878E-19	321	0.043	0.243	2h9lA.pdb.gz
12	PDB:7mq8LR	0.094	0.197	1.010E-18	773	0.042	0.098	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:5k1aF	0.153	0.424	1.737E-18	600	0.038	0.117	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:5o9zL	0.145	0.510	1.129E-17	459	0.052	0.207	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
15	PDB:7mqaLQ	0.102	0.210	1.246E-17	830	0.041	0.089	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	AFDB:M9PB01	0.148	0.114	9.242E-17	2397	0.131	0.099	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
17	AFDB:O43379	0.152	0.180	1.935E-16	1518	0.100	0.121	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
18	AFDB:Q4GYD0	0.140	0.167	3.330E-12	1484	0.105	0.129	Q4GYD0.pdb.gz	Q4GYD0_TRYB2 Minichromosome loss protein Mcl1 middle region domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4480 PE=4 SV=1
19	AFDB:Q55BR7	0.146	0.175	1.010E-9	1509	0.022	0.027	Q55BR7.pdb.gz	RPTOR_DICDI Protein raptor homolog OS=Dictyostelium discoideum OX=44689 GN=raptor PE=1 SV=1
20	AFDB:Q6S003	0.140	0.136	4.061E-8	1873	0.041	0.040	Q6S003.pdb.gz	KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum OX=44689 GN=kif8 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6RI45	0.0	1862	1802	0.511	0.516	BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BRWD3 PE=1 SV=2
2	Q8VDD9	0.0	3477	1821	0.948	0.948	PHIP_MOUSE PH-interacting protein OS=Mus musculus OX=10090 GN=Phip PE=1 SV=2
3	Q8WWQ0	0.0	3800	1821	1.000	1.000	PHIP_HUMAN PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2
4	Q921C3	0.0	1783	2304	0.488	0.386	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
5	Q9NSI6	0.0	1819	2320	0.500	0.393	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
6	Q9VC96	0.0	672	2232	0.177	0.145	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
7	Q8SX63	3.67e-156	526	1765	0.153	0.158	Q8SX63_DROME LD40380p OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=2 SV=1
8	Q57W14	7.99e-30	126	419	0.054	0.236	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
9	Q8N136	1.38e-29	125	415	0.050	0.219	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
10	Q9D4T2	5.61e-28	118	304	0.048	0.289	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
11	D3Z7A5	2.43e-26	116	415	0.049	0.214	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
12	Q3Y8L7	1.81e-25	114	446	0.051	0.209	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
13	Q9VZF4	1.00e-24	115	1326	0.049	0.067	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
14	Q1LV15	5.19e-24	109	415	0.047	0.207	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
15	Q93794	8.06e-23	107	587	0.048	0.148	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3
16	Q7ZUV2	3.44e-22	106	694	0.037	0.098	KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio OX=7955 GN=katnb1 PE=2 SV=1
17	Q8VBV4	3.89e-22	106	710	0.052	0.132	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
18	Q969H0	5.59e-22	105	707	0.052	0.133	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
19	Q8BG40	1.36e-21	104	658	0.036	0.100	KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus OX=10090 GN=Katnb1 PE=1 SV=1
20	Q4VFZ4	1.78e-21	103	655	0.036	0.101	Q4VFZ4_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.085	24.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00439 Bromodomain	4.4e-35	130.9	Bromodomain
3	PF00527 E7	2.5e+02	13.3	E7 protein, Early protein
4	PF10117 McrBC	1.6e+02	12.6	McrBC 5-methylcytosine restriction system component
5	PF20426 NBCH_WD40	0.0027	28.2	Neurobeachin beta propeller domain
6	PF00400 WD40	4.7e-30	114.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000275034

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301764	0.935	DNA damage-binding protein 1
2	9606.ENSP00000364589	0.908	Cullin-4A
3	9606.ENSP00000304895	0.879	Insulin receptor substrate 1
4	9606.ENSP00000362441	0.873	Transcriptional regulator ATRX
5	9606.ENSP00000384109	0.869	Cullin-4B
6	9606.ENSP00000282516	0.851	Nipped-B-like protein
7	9606.ENSP00000351575	0.830	Transcription factor TFIIIB component B'' homolog
8	9606.ENSP00000330753	0.824	Bromodomain and WD repeat-containing protein 1
9	9606.ENSP00000358374	0.812	Protein SCAF11
10	9606.ENSP00000238789	0.782	ATPase family, AAA domain containing 2B
11	9606.ENSP00000358956	0.749	Interleukin-1 receptor-associated kinase 1-binding protein 1
12	9606.ENSP00000362774	0.748	Roquin-2
13	9606.ENSP00000307208	0.733	Nucleosome-remodeling factor subunit BPTF
14	9606.ENSP00000290650	0.726	E3 ubiquitin-protein ligase UBR1
15	9606.ENSP00000450337	0.719	Liprin-alpha-2
16	9606.ENSP00000356579	0.715	Centrosome-associated protein 350
17	9606.ENSP00000323275	0.714	Dynein assembly factor 4, axonemal
18	9606.ENSP00000402515	0.713	Serine/threonine-protein kinase SMG1
19	9606.ENSP00000361597	0.708	Spermatogenesis-associated protein 25
20	9606.ENSP00000245957	0.707	Cilia- and flagella-associated protein 61

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042393	0.347	histone binding
GO:0003824	0.300	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0051252	0.972	regulation of RNA metabolic process
GO:2001141	0.962	regulation of RNA biosynthetic process
GO:1903506	0.948	regulation of nucleic acid-templated transcription
GO:0010604	0.934	positive regulation of macromolecule metabolic process
GO:0010468	0.929	regulation of gene expression
GO:0051173	0.899	positive regulation of nitrogen compound metabolic process
GO:0048523	0.898	negative regulation of cellular process
GO:0071840	0.893	cellular component organization or biogenesis
GO:0048522	0.892	positive regulation of cellular process
GO:0016043	0.859	cellular component organization
GO:0006355	0.846	regulation of DNA-templated transcription
GO:0048583	0.828	regulation of response to stimulus
GO:0023051	0.687	regulation of signaling
GO:0009966	0.684	regulation of signal transduction
GO:0071704	0.620	organic substance metabolic process
GO:0045935	0.553	positive regulation of nucleobase-containing compound metabolic process
GO:0044238	0.540	primary metabolic process
GO:0010557	0.534	positive regulation of macromolecule biosynthetic process
GO:0031328	0.521	positive regulation of cellular biosynthetic process
GO:0043170	0.501	macromolecule metabolic process
GO:0006807	0.441	nitrogen compound metabolic process
GO:0045893	0.434	positive regulation of DNA-templated transcription
GO:0010941	0.417	regulation of cell death
GO:0050896	0.376	response to stimulus
GO:0043069	0.337	negative regulation of programmed cell death
GO:0043066	0.327	negative regulation of apoptotic process
GO:0043412	0.301	macromolecule modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.953	nuclear lumen
GO:0005654	0.919	nucleoplasm
GO:0043232	0.836	intracellular non-membrane-bounded organelle
GO:0005737	0.739	cytoplasm
GO:0005829	0.512	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]