StarFunc result for job id Q8WWQ8

User Input

>input (2551 residues)
MMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTM
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT
CECYSAYTGPKCDKPIPECAALLCPENSRCSPSTEDENKLECKCLPNYRGDGKYCDPINP
CLRKICHPHAHCTYLGPNRHSCTCQEGYRGDGQVCLPVDPCQINFGNCPTKSTVCKYDGP
GQSHCECKEHYQNFVPGVGCSMTDICKSDNPCHRNANCTTVAPGRTECICQKGYVGDGLT
CYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNV
NELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIFNSDKDNQIKLKLHGG
KKKVKIIQGDIIASNGLLHILDRAMDKLEPTFESNNEQTIMTMLQPRYSKFRSLLEETNL
GHALDEDGVGGPYTIFVPNNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVA
TLISTPHIRSMANQLIQFNTTDNGQILANDVAMEEIEITAKNGRIYTLTGVLIPPSIVPI
LPHRCDETKREMKLGTCVSCSLVYWSRCPANSEPTALFTHRCVYSGRFGSLKSGCARYCN
ATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADSLGGNGTCICEEGFQGSQCQFCSD
PNKYGPRCNKKCLCVHGTCNNRIDSDGACLTGTCRDGSAGRLCDKQTSACGPYVQFCHIH
ATCEYSNGTASCICKAGYEGDGTLCSEMDPCTGLTPGGCSRNAECIKTGTGTHTCVCQQG
WTGNGRDCSEINNCLLPSAGGCHDNASCLYVGPGQNECECKKGFRGNGIDCEPITSCLEQ
TGKCHPLASCQSTSSGVWSCVCQEGYEGDGFLCYGNAAVELSFLSEAAIFNRWINNASLQ
PTLSATSNLTVLVPSQQATEDMDQDEKSFWLSQSNIPALIKYHMLLGTYRVADLQTLSSS
DMLATSLQGNFLHLAKVDGNITIEGASIVDGDNAATNGVIHIINKVLVPQRRLTGSLPNL
LMRLEQMPDYSIFRGYIIQYNLANAIEAADAYTVFAPNNNAIENYIREKKVLSLEEDVLR
YHVVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHG
LGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLF
IGCQPKCVRTVITRECCAGFFGPQCQPCPGNAQNVCFGNGICLDGVNGTGVCECGEGFSG
TACETCTEGKYGIHCDQACSCVHGRCNQGPLGDGSCDCDVGWRGVHCDNATTEDNCNGTC
HTSANCLTNSDGTASCKCAAGFQGNGTICTAINACEISNGGCSAKADCKRTTPGRRVCTC
KAGYTGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGKVCTLINVCL
TKNGGCSEFAICNHTGQVERTCTCKPNYIGDGFTCRGSIYQELPKNPKTSQYFFQLQEHF
VKDLVGPGPFTVFAPLSAAFDEEARVKDWDKYGLMPQVLRYHVVACHQLLLENLKLISNA
TSLQGEPIVISVSQSTVYINNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDNSGRI
LQNLTTLATNNGYIKFSNLIQDSGLLSVITDPIHTPVTLFWPTDQALHALPAEQQDFLFN
QDNKDKLKEYLKFHVIRDAKVLAVDLPTSTAWKTLQGSELSVKCGAGRDIGDLFLNGQTC
RIVQRELLFDLGVAYGIDCLLIDPTLGGRCDTFTTFDASGECGSCVNTPSCPRWSKPKGV
KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY
SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGITGSGQCLCETGWTGPS
CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS
QKGTKVSCSCQKGYKGDGHSCTEIDPCADGLNGGCHEHATCKMTGPGKHKCECKSHYVGD
GLNCEPEQLPIDRCLQDNGQCHADAKCVDLHFQDTTVGVFHLRSPLGQYKLTFDKAREAC
ANEAATMATYNQLSYAQKAKYHLCSAGWLETGRVAYPTAFASQNCGSGVVGIVDYGPRPN
KSEMWDVFCYRMKDVNCTCKVGYVGDGFSCSGNLLQVLMSFPSLTNFLTEVLAYSNSSAR
GRAFLEHLTDLSIRGTLFVPQNSGLGENETLSGRDIEHHLANVSMFFYNDLVNGTTLQTR
LGSKLLITASQDPLQPTETRFVDGRAILQWDIFASNGIIHVISRPLKAPPAPVTLTHTGL
GAGIFFAIILVTGAVALAAYSYFRINRRTIGFQHFESEEDINVAALGKQQPENISNPLYE
STTSAPPEPSYDPFTDSEERQLEGNDPLRTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0CZJ3	0.248	0.248	0.000	2553	0.398	0.398	E0CZJ3.pdb.gz	E0CZJ3_DANRE FEEL-1 OS=Danio rerio OX=7955 GN=FEEL-1 PE=1 SV=1
2	AFDB:F6P8Y7	0.337	0.337	0.000	2543	0.484	0.485	F6P8Y7.pdb.gz	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
3	AFDB:Q8CFM6	0.220	0.370	0.000	1431	0.430	0.767	Q8CFM6.pdb.gz	STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Stab2 PE=1 SV=1
4	AFDB:Q8R4U0	0.278	0.278	0.000	2559	0.781	0.778	Q8R4U0.pdb.gz	STAB2_MOUSE Stabilin-2 OS=Mus musculus OX=10090 GN=Stab2 PE=1 SV=1
5	AFDB:Q8WWQ8	1.000	1.000	0.000	2551	1.000	1.000	Q8WWQ8.pdb.gz	STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
6	AFDB:Q9NY15	0.227	0.226	0.000	2570	0.409	0.406	Q9NY15.pdb.gz	STAB1_HUMAN Stabilin-1 OS=Homo sapiens OX=9606 GN=STAB1 PE=1 SV=3
7	AFDB:A8KBK2	0.119	0.403	2.948E-69	659	0.121	0.467	A8KBK2.pdb.gz
8	AFDB:A0A0B5JSG0	0.073	0.217	1.099E-26	677	0.052	0.195	A0A0B5JSG0.pdb.gz
9	AFDB:A0A140LGI0	0.047	0.089	1.871E-15	1176	0.065	0.142	A0A140LGI0.pdb.gz
10	AFDB:P01132	0.045	0.078	1.861E-13	1217	0.074	0.156	P01132.pdb.gz	EGF_MOUSE Pro-epidermal growth factor OS=Mus musculus OX=10090 GN=Egf PE=1 SV=2
11	PDB:7q3nU	0.037	0.214	9.812E-7	292	0.020	0.171	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:1nyoA	0.050	0.722	1.473E-5	163	0.011	0.166	1nyoA.pdb.gz
13	PDB:5es4B	0.024	0.061	8.762E-3	674	0.022	0.083	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
14	PDB:4g1eB	0.032	0.091	1.191E-2	709	0.020	0.071	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
15	PDB:1u8cB	0.025	0.088	2.083E-1	599	0.013	0.055	1u8cB.pdb.gz	A novel adaptation of the integrin PSI domain revealed from its crystal structure.
16	PDB:4e0sB	0.023	0.038	2.556E-1	898	0.019	0.053	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
17	PDB:3n6rA	0.025	0.080	5.227E-1	591	0.014	0.059	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
18	PDB:1rfxA	0.016	0.205	6.093E-1	89	0.004	0.112	1rfxA.pdb.gz
19	PDB:3n6rG	0.025	0.069	7.103E-1	646	0.012	0.048	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
20	PDB:3t5oA	0.018	0.039	7.868E-1	871	0.013	0.039	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C6GHV6	0.0	2324	2508	0.465	0.473	C6GHV6_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
2	E0CZJ3	0.0	1887	2553	0.406	0.406	E0CZJ3_DANRE FEEL-1 OS=Danio rerio OX=7955 GN=FEEL-1 PE=1 SV=1
3	F6P8Y7	0.0	2491	2543	0.485	0.486	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
4	Q8CFM6	0.0	2256	1431	0.431	0.768	STAB2_RAT Stabilin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Stab2 PE=1 SV=1
5	Q8R4U0	0.0	4194	2559	0.782	0.780	STAB2_MOUSE Stabilin-2 OS=Mus musculus OX=10090 GN=Stab2 PE=1 SV=1
6	Q8WWQ8	0.0	5251	2551	1.000	1.000	STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
7	Q9NY15	0.0	1933	2570	0.411	0.408	STAB1_HUMAN Stabilin-1 OS=Homo sapiens OX=9606 GN=STAB1 PE=1 SV=3
8	B0BN34	1.72e-23	105	275	0.018	0.164	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
9	O08859	2.31e-23	104	275	0.018	0.164	TSG6_MOUSE Tumor necrosis factor-inducible gene 6 protein OS=Mus musculus OX=10090 GN=Tnfaip6 PE=1 SV=1
10	P98066	3.81e-23	103	277	0.018	0.162	TSG6_HUMAN Tumor necrosis factor-inducible gene 6 protein OS=Homo sapiens OX=9606 GN=TNFAIP6 PE=1 SV=2
11	O60494	2.96e-17	92.0	3623	0.033	0.023	CUBN_HUMAN Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5
12	O70244	1.70e-15	86.3	3623	0.033	0.023	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2
13	Q9VTP0	5.07e-15	84.7	3613	0.036	0.025	Q9VTP0_DROME Cubulin 2 OS=Drosophila melanogaster OX=7227 GN=Cubn2 PE=4 SV=4
14	O88322	8.12e-15	83.6	1403	0.022	0.041	NID2_MOUSE Nidogen-2 OS=Mus musculus OX=10090 GN=Nid2 PE=1 SV=2
15	A4JYQ1	1.26e-14	80.1	337	0.022	0.166	A4JYQ1_DANRE Hyaluronan and proteoglycan link protein 2 precursor OS=Danio rerio OX=7955 GN=wu:fj51g03 PE=1 SV=1
16	C7FZU3	2.14e-14	82.4	1527	0.031	0.052	C7FZU3_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=1
17	Q9WTS6	2.35e-14	82.4	2715	0.025	0.024	TEN3_MOUSE Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1
18	Q93791	2.65e-14	82.0	1584	0.027	0.044	Q93791_CAEEL Nidogen OS=Caenorhabditis elegans OX=6239 GN=nid-1 PE=1 SV=2
19	Q9JLB4	2.69e-14	82.4	3623	0.033	0.023	CUBN_MOUSE Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3
20	P10493	3.67e-14	81.6	1245	0.026	0.053	NID1_MOUSE Nidogen-1 OS=Mus musculus OX=10090 GN=Nid1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	11	17.4	Complement Clr-like EGF-like
2	PF00008 EGF	1.8	20.3	EGF-like domain
3	PF12947 EGF_3	2.7e-78	269.1	EGF domain
4	PF12946 EGF_MSP1_1	5.2	18.5	MSP1 EGF domain 1
5	PF02469 Fasciclin	4.9e-126	426.2	Fasciclin domain
6	PF14670 FXa_inhibition	5.5	18.7	Coagulation Factor Xa inhibitory site
7	PF00193 Xlink	5.3e-25	98.9	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373539

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377492	0.961	Hyaluronan mediated motility receptor
2	9606.ENSP00000256178	0.960	Lymphatic vessel endothelial hyaluronic acid receptor 1
3	9606.ENSP00000386289	0.954	PTB domain-containing engulfment adapter protein 1
4	9606.ENSP00000398632	0.938	CD44 antigen
5	9606.ENSP00000430945	0.793	Adhesion G protein-coupled receptor B1
6	9606.ENSP00000274532	0.738	T-cell immunoglobulin and mucin domain-containing protein 4
7	9606.ENSP00000401853	0.691	Hyaluronidase-2
8	9606.ENSP00000268150	0.670	Lactadherin
9	9606.ENSP00000280758	0.642	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
10	9606.ENSP00000233242	0.637	Apolipoprotein B-100
11	9606.ENSP00000321826	0.630	Syntaxin-binding protein 5
12	9606.ENSP00000316228	0.619	C-type lectin domain family 4 member M
13	9606.ENSP00000335632	0.612	Calcineurin B homologous protein 1
14	9606.ENSP00000263980	0.609	Sodium/hydrogen exchanger 1
15	9606.ENSP00000261402	0.605	NUAK family SNF1-like kinase 1
16	9606.ENSP00000387882	0.601	Synaptotagmin like tandem C2 proteins
17	9606.ENSP00000399421	0.584	Platelet glycoprotein 4
18	9606.ENSP00000314724	0.580	Liprin-beta-1
19	9606.ENSP00000290246	0.571	Engulfment and cell motility protein 2
20	9606.ENSP00000312185	0.562	Engulfment and cell motility protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005044	1.000	scavenger receptor activity
GO:0005041	0.999	low-density lipoprotein particle receptor activity
GO:0030169	0.998	low-density lipoprotein particle binding
GO:0097367	0.633	carbohydrate derivative binding
GO:0005539	0.475	glycosaminoglycan binding
GO:0005540	0.393	hyaluronic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.967	response to stimulus
GO:0009987	0.914	cellular process
GO:0065007	0.869	biological regulation
GO:0050789	0.828	regulation of biological process
GO:0006810	0.808	transport
GO:0006950	0.805	response to stress
GO:0016192	0.731	vesicle-mediated transport
GO:0006897	0.718	endocytosis
GO:0006898	0.701	receptor-mediated endocytosis
GO:0009605	0.625	response to external stimulus
GO:0044419	0.573	biological process involved in interspecies interaction between organisms
GO:0050794	0.564	regulation of cellular process
GO:0048518	0.558	positive regulation of biological process
GO:0006952	0.556	defense response
GO:0071704	0.534	organic substance metabolic process
GO:0051707	0.519	response to other organism
GO:0009617	0.514	response to bacterium
GO:0032501	0.429	multicellular organismal process
GO:0032502	0.394	developmental process
GO:0048856	0.324	anatomical structure development
GO:0006807	0.316	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031410	0.994	cytoplasmic vesicle
GO:0005829	0.991	cytosol
GO:0031090	0.957	organelle membrane
GO:0030139	0.947	endocytic vesicle
GO:0098588	0.921	bounding membrane of organelle
GO:0030659	0.873	cytoplasmic vesicle membrane
GO:0030666	0.778	endocytic vesicle membrane
GO:0012505	0.355	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]