StarFunc result for job id Q8WWV3

User Input

>input (396 residues)
MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFT
QNMMMPIIHYPNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLG
RDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAAS
LPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDA
SELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTL
VTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAG
KIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWV3	1.000	1.000	2.035E-88	396	1.000	1.000	Q8WWV3.pdb.gz	RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RTN4IP1 PE=1 SV=2
2	AFDB:Q7T3C7	0.910	0.931	3.306E-68	387	0.646	0.661	Q7T3C7.pdb.gz	RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio OX=7955 GN=rtn4ip1 PE=2 SV=2
3	AFDB:Q8IPZ3	0.829	0.796	2.657E-42	413	0.343	0.329	Q8IPZ3.pdb.gz	Q8IPZ3_DROME FI02982p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17221 PE=1 SV=1
4	AFDB:Q4W4Z2	0.866	0.935	5.101E-41	366	0.336	0.363	Q4W4Z2.pdb.gz	RT4I1_CAEEL Reticulon-4-interacting protein 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=rad-8 PE=2 SV=2
5	AFDB:Q9LK96	0.810	0.874	7.020E-39	366	0.313	0.339	Q9LK96.pdb.gz	Q9LK96_ARATH AT3g15090/K15M2_24 OS=Arabidopsis thaliana OX=3702 GN=At3g15090 PE=1 SV=1
6	AFDB:Q9SV68	0.744	0.888	2.147E-31	329	0.255	0.307	Q9SV68.pdb.gz	QORH_ARATH Chloroplast envelope quinone oxidoreductase homolog OS=Arabidopsis thaliana OX=3702 GN=CEQORH PE=1 SV=1
7	AFDB:Q9ZUC1	0.694	0.711	3.106E-31	386	0.290	0.298	Q9ZUC1.pdb.gz	AOR_ARATH NADPH-dependent alkenal/one oxidoreductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AOR PE=1 SV=2
8	AFDB:O42909	0.737	0.834	3.736E-31	347	0.230	0.262	O42909.pdb.gz	YBI2_SCHPO Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16A3.02c PE=3 SV=1
9	PDB:5a3jC	0.723	0.866	1.769E-30	327	0.260	0.315	5a3jC.pdb.gz	Crystal Structure of the Chloroplastic Oxoene Reductase ceQORH from Arabidopsis thaliana.
10	AFDB:Q582N8	0.672	0.778	1.615E-27	339	0.237	0.277	Q582N8.pdb.gz	Q582N8_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.760 PE=4 SV=1
11	AFDB:O94564	0.685	0.779	7.526E-27	346	0.235	0.269	O94564.pdb.gz	YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1773.06c PE=3 SV=1
12	PDB:1yb5A	0.668	0.804	2.258E-25	324	0.207	0.253	1yb5A.pdb.gz	Crystal Structure of human Zeta-Crystallin at 1.85A
13	PDB:3qwaB	0.692	0.819	3.072E-25	332	0.210	0.250	3qwaB.pdb.gz
14	PDB:6k9yA	0.680	0.781	4.076E-24	342	0.202	0.234	6k9yA.pdb.gz
15	PDB:2obyA	0.695	0.816	6.272E-24	334	0.235	0.278	2obyA.pdb.gz	Crystal structure of human P53 inducible oxidoreductase (TP53I3, PIG3)
16	PDB:3hzzB	0.715	0.637	4.782E-23	447	0.230	0.204	3hzzB.pdb.gz
17	PDB:1qorA	0.666	0.799	1.853E-22	326	0.210	0.255	1qorA.pdb.gz	Crystal structure of Escherichia coli QOR quinone oxidoreductase complexed with NADPH.
18	PDB:5envA	0.670	0.757	2.095E-22	347	0.164	0.187	5envA.pdb.gz	Mechanistic implications from structures of yeast alcohol dehydrogenase complexed with coenzyme and an alcohol.
19	PDB:8b27B	0.628	0.759	5.610E-22	322	0.162	0.199	8b27B.pdb.gz
20	PDB:3b70A	0.639	0.703	7.632E-22	357	0.205	0.227	3b70A.pdb.gz	Crystal structure and biochemical studies of the trans-acting polyketide enoyl reductase LovC from lovastatin biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2R9Y1	0.0	731	354	0.894	1.000	B2R9Y1_HUMAN cDNA, FLJ94608, Homo sapiens reticulon 4 interacting protein 1 (RTN4IP1), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	Q7T3C7	0.0	555	387	0.652	0.667	RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio OX=7955 GN=rtn4ip1 PE=2 SV=2
3	Q8WWV3	0.0	818	396	1.000	1.000	RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RTN4IP1 PE=1 SV=2
4	Q924D0	0.0	745	396	0.904	0.904	RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Rtn4ip1 PE=1 SV=2
5	Q4W4Z2	9.90e-75	238	366	0.341	0.369	RT4I1_CAEEL Reticulon-4-interacting protein 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=rad-8 PE=2 SV=2
6	Q8SZK7	2.65e-59	200	413	0.336	0.322	Q8SZK7_DROME RH24774p OS=Drosophila melanogaster OX=7227 GN=CG17221 PE=2 SV=1
7	Q8IPZ3	3.60e-59	199	413	0.338	0.324	Q8IPZ3_DROME FI02982p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17221 PE=1 SV=1
8	Q9VQL4	4.55e-59	197	362	0.333	0.365	Q9VQL4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=DM_7295851 PE=3 SV=1
9	Q9LK96	2.26e-53	183	366	0.323	0.350	Q9LK96_ARATH AT3g15090/K15M2_24 OS=Arabidopsis thaliana OX=3702 GN=At3g15090 PE=1 SV=1
10	Q9ZUC1	1.98e-35	135	386	0.283	0.290	AOR_ARATH NADPH-dependent alkenal/one oxidoreductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AOR PE=1 SV=2
11	Q9SV68	1.39e-30	121	329	0.265	0.319	QORH_ARATH Chloroplast envelope quinone oxidoreductase homolog OS=Arabidopsis thaliana OX=3702 GN=CEQORH PE=1 SV=1
12	O42909	1.20e-27	114	347	0.250	0.285	YBI2_SCHPO Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16A3.02c PE=3 SV=1
13	O94564	2.31e-21	96.3	346	0.235	0.269	YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1773.06c PE=3 SV=1
14	Q08257	2.49e-21	95.9	329	0.232	0.280	QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1
15	P11415	7.66e-20	91.7	329	0.182	0.219	QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus OX=10141 GN=CRYZ PE=1 SV=1
16	Q6AYT0	7.02e-19	89.0	329	0.225	0.271	QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Cryz PE=2 SV=1
17	P28625	9.34e-19	89.0	365	0.227	0.247	YIM1_YEAST Protein YIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIM1 PE=1 SV=2
18	O97764	7.41e-18	85.9	330	0.174	0.209	QOR_BOVIN Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2
19	O65423	1.54e-17	85.1	325	0.250	0.305	O65423_ARATH AT4g21580/F18E5_200 OS=Arabidopsis thaliana OX=3702 GN=F18E5.200 PE=1 SV=1
20	P72043	5.81e-17	83.2	328	0.235	0.284	P72043_MYCTU Probable oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3777 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08240 ADH_N	4.9e-05	34.6	Alcohol dehydrogenase GroES-like domain
2	PF00107 ADH_zinc_N	1e-09	49.9	Zinc-binding dehydrogenase
3	PF13602 ADH_zinc_N_2	6e-21	87.3	Zinc-binding dehydrogenase
4	PF00208 ELFV_dehydrog	3.7e+02	12.2	Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
5	PF13578 Methyltransf_24	3.7e+02	13.6	Methyltransferase domain
6	PF01118 Semialdhyde_dh	2.6e+02	13.5	Semialdehyde dehydrogenase, NAD binding domain
7	PF02882 THF_DHG_CYH_C	66	14.2	Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358059

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337838	0.919	Reticulon-4
2	9606.ENSP00000263702	0.886	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
3	9606.ENSP00000264029	0.757	Trehalase
4	9606.ENSP00000386156	0.699	Partner of Y14 and mago
5	9606.ENSP00000324422	0.682	Zyxin
6	9606.ENSP00000306887	0.650	Transmembrane protein 126A
7	9606.ENSP00000303525	0.644	Carbonyl reductase family member 4
8	9606.ENSP00000384867	0.640	Uncharacterized protein C6orf203
9	9606.ENSP00000402338	0.620	Ribosome production factor 2 homolog
10	9606.ENSP00000301329	0.606	Glyoxalase domain containing 4
11	9606.ENSP00000376168	0.589	Centromere protein X
12	9606.ENSP00000411268	0.558	BEN domain-containing protein 3
13	9606.ENSP00000363999	0.556	Mitochondrial ribosomal protein L50
14	9606.ENSP00000323304	0.546	Leucine rich single-pass membrane protein 1
15	9606.ENSP00000251588	0.541	Cytosolic Fe-S cluster assembly factor NARFL
16	9606.ENSP00000216254	0.537	Aconitate hydratase, mitochondrial
17	9606.ENSP00000357998	0.531	Translocation protein SEC63 homolog
18	9606.ENSP00000193322	0.511	Osteopetrosis-associated transmembrane protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.974	catalytic activity
GO:0016491	0.898	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.939	regulation of biological process
GO:0050794	0.858	regulation of cellular process
GO:0009987	0.826	cellular process
GO:0051128	0.487	regulation of cellular component organization
GO:0031344	0.359	regulation of cell projection organization
GO:0032502	0.305	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.970	membrane
GO:0031090	0.875	organelle membrane
GO:0070013	0.538	intracellular organelle lumen
GO:0031967	0.460	organelle envelope
GO:0031966	0.315	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.898	Oxidoreductases.

[back to server]