StarFunc result for job id Q8WWW0

User Input

>input (418 residues)
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWW0	1.000	1.000	3.820E-77	418	1.000	1.000	Q8WWW0.pdb.gz	RASF5_HUMAN Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1
2	AFDB:Q9NS23	0.452	0.538	1.153E-33	344	0.364	0.442	Q9NS23.pdb.gz	RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1
3	AFDB:Q68FW0	0.355	0.533	4.486E-27	270	0.289	0.448	Q68FW0.pdb.gz
4	AFDB:F0IWT2	0.202	0.048	3.316E-4	1880	0.062	0.014	F0IWT2.pdb.gz	F0IWT2_CAEEL Unconventional myosin-IXa-like OS=Caenorhabditis elegans OX=6239 GN=hum-7 PE=1 SV=1
5	AFDB:F6P6M2	0.106	0.029	1.802E-3	1753	0.100	0.024	F6P6M2.pdb.gz	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
6	AFDB:Q3UVC0	0.130	0.062	3.955E-3	959	0.112	0.049	Q3UVC0.pdb.gz	KSR2_MOUSE Kinase suppressor of Ras 2 OS=Mus musculus OX=10090 GN=Ksr2 PE=1 SV=3
7	AFDB:Q9XUS9	0.111	0.069	3.955E-3	681	0.086	0.053	Q9XUS9.pdb.gz	Q9XUS9_CAEEL Rac GTPase-activating protein 1 OS=Caenorhabditis elegans OX=6239 GN=cyk-4 PE=1 SV=1
8	AFDB:Q61097	0.115	0.060	6.415E-3	873	0.100	0.048	Q61097.pdb.gz	KSR1_MOUSE Kinase suppressor of Ras 1 OS=Mus musculus OX=10090 GN=Ksr1 PE=1 SV=1
9	AFDB:Q8IVT5	0.120	0.058	1.040E-2	923	0.098	0.044	Q8IVT5.pdb.gz	KSR1_HUMAN Kinase suppressor of Ras 1 OS=Homo sapiens OX=9606 GN=KSR1 PE=1 SV=3
10	AFDB:A0A2R8Y5H9	0.115	0.058	1.174E-2	928	0.096	0.043	A0A2R8Y5H9.pdb.gz	A0A2R8Y5H9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=KSR1 PE=1 SV=1
11	PDB:1xa6A	0.117	0.122	1.251E-2	399	0.038	0.040	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
12	PDB:3plvA	0.134	0.542	1.411E-2	80	0.033	0.175	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
13	PDB:4ajwA	0.130	0.077	1.797E-2	765	0.031	0.017	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
14	PDB:4pyuA	0.150	0.657	1.909E-2	76	0.024	0.132	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
15	PDB:7rbsB	0.129	0.295	3.290E-2	157	0.029	0.076	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
16	PDB:5azhA	0.159	0.412	3.495E-2	127	0.050	0.165	5azhA.pdb.gz
17	PDB:6lanA	0.157	0.401	3.713E-2	133	0.053	0.165	6lanA.pdb.gz
18	PDB:4yknA	0.153	0.060	3.944E-2	1205	0.041	0.014	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
19	PDB:6mdhA	0.138	0.340	3.944E-2	149	0.022	0.060	6mdhA.pdb.gz
20	PDB:3dbhI	0.130	0.505	4.451E-2	86	0.038	0.186	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5EBH1	0.0	682	413	0.844	0.855	RASF5_MOUSE Ras association domain-containing protein 5 OS=Mus musculus OX=10090 GN=Rassf5 PE=1 SV=1
2	Q8WWW0	0.0	847	418	1.000	1.000	RASF5_HUMAN Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1
3	Q5FAQ9	1.11e-92	284	340	0.371	0.456	Q5FAQ9_RAT Ras association domain family member 1 OS=Rattus norvegicus OX=10116 GN=Rassf1 PE=4 SV=1
4	Q99MK9	2.72e-92	283	340	0.371	0.456	RASF1_MOUSE Ras association domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rassf1 PE=1 SV=1
5	Q9NS23	2.58e-87	271	344	0.354	0.430	RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1
6	Q86WH2	9.05e-55	183	238	0.244	0.429	RASF3_HUMAN Ras association domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RASSF3 PE=1 SV=1
7	Q22744	2.48e-34	137	615	0.203	0.138	RASF1_CAEEL Ras association domain-containing protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rsf-1 PE=1 SV=1
8	P50749	2.56e-12	69.7	326	0.108	0.138	RASF2_HUMAN Ras association domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RASSF2 PE=1 SV=1
9	Q8BMS9	4.97e-12	68.9	326	0.105	0.135	RASF2_MOUSE Ras association domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rassf2 PE=1 SV=1
10	Q6ZTQ3	1.95e-06	52.0	369	0.093	0.106	RASF6_HUMAN Ras association domain-containing protein 6 OS=Homo sapiens OX=9606 GN=RASSF6 PE=1 SV=1
11	Q9VCQ7	9.42e-06	50.4	806	0.084	0.043	Q9VCQ7_DROME LD40758p OS=Drosophila melanogaster OX=7227 GN=Rassf PE=1 SV=3
12	Q80UQ2	1.70e-05	48.9	341	0.098	0.120	RASF6_MOUSE Ras association domain-containing protein 6 OS=Mus musculus OX=10090 GN=Rassf6 PE=1 SV=2
13	M0QZC2	2.76e-04	42.0	94	0.038	0.170	M0QZC2_HUMAN Protein kinase D2 (Fragment) OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=1
14	Q02956	0.001	43.1	592	0.060	0.042	KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus OX=10090 GN=Prkcz PE=1 SV=2
15	Q6DBR6	0.003	42.0	334	0.038	0.048	STAC3_DANRE SH3 and cysteine-rich domain-containing protein 3 OS=Danio rerio OX=7955 GN=stac3 PE=1 SV=1
16	Q05513	0.004	42.0	592	0.089	0.062	KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens OX=9606 GN=PRKCZ PE=1 SV=4
17	Q4KUS2	0.005	42.0	1712	0.081	0.020	UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3
18	Q9UPW8	0.005	41.6	1703	0.081	0.020	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
19	Q9BZL6	0.006	41.6	878	0.045	0.022	KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3
20	Q62768	0.007	41.2	1735	0.079	0.019	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.0044	28.2	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	1.2	20.9	C1 domain
3	PF16517 Nore1-SARAH	5.3e-14	63.0	Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
4	PF00788 RA	1.5e-11	56.1	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361892	0.999	Serine/threonine-protein kinase 4
2	9606.ENSP00000407586	0.998	GTPase HRas
3	9606.ENSP00000359206	0.982	F-box/WD repeat-containing protein 1A
4	9606.ENSP00000358723	0.981	Ras-related protein Rap-1A
5	9606.ENSP00000258149	0.968	E3 ubiquitin-protein ligase Mdm2
6	9606.ENSP00000338171	0.965	Src kinase-associated phosphoprotein 1
7	9606.ENSP00000429744	0.951	Serine/threonine-protein kinase 3
8	9606.ENSP00000250559	0.948	Ras-related protein Rap-1b
9	9606.ENSP00000326031	0.942	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
10	9606.ENSP00000385571	0.935	Homeodomain-interacting protein kinase 2
11	9606.ENSP00000246792	0.927	Ras-related protein R-Ras
12	9606.ENSP00000256078	0.927	GTPase KRas
13	9606.ENSP00000289104	0.908	Ras-related protein M-Ras
14	9606.ENSP00000349547	0.907	Ras association domain-containing protein 1
15	9606.ENSP00000380948	0.902	Integrin beta-2
16	9606.ENSP00000358571	0.890	Homeodomain-interacting protein kinase 1
17	9606.ENSP00000256196	0.884	Ras-related protein R-Ras2
18	9606.ENSP00000349252	0.881	Integrin alpha-L
19	9606.ENSP00000358548	0.878	GTPase NRas
20	9606.ENSP00000395708	0.850	Rap guanine nucleotide exchange factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0019899	0.421	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0009987	0.984	cellular process
GO:0002682	0.970	regulation of immune system process
GO:0048519	0.969	negative regulation of biological process
GO:0051239	0.966	regulation of multicellular organismal process
GO:0048523	0.959	negative regulation of cellular process
GO:0019222	0.951	regulation of metabolic process
GO:0050865	0.944	regulation of cell activation
GO:0031398	0.942	positive regulation of protein ubiquitination
GO:0042127	0.922	regulation of cell population proliferation
GO:0051249	0.911	regulation of lymphocyte activation
GO:0050896	0.873	response to stimulus
GO:0051716	0.803	cellular response to stimulus
GO:0007154	0.754	cell communication
GO:0023052	0.751	signaling
GO:0007165	0.744	signal transduction
GO:0032501	0.739	multicellular organismal process
GO:0002376	0.713	immune system process
GO:0070663	0.676	regulation of leukocyte proliferation
GO:0008285	0.672	negative regulation of cell population proliferation
GO:0032944	0.620	regulation of mononuclear cell proliferation
GO:0048522	0.524	positive regulation of cellular process
GO:0001775	0.515	cell activation
GO:0070661	0.484	leukocyte proliferation
GO:1900180	0.484	regulation of protein localization to nucleus
GO:0035556	0.483	intracellular signal transduction
GO:0051241	0.433	negative regulation of multicellular organismal process
GO:0050670	0.426	regulation of lymphocyte proliferation
GO:0048583	0.424	regulation of response to stimulus
GO:0050866	0.401	negative regulation of cell activation
GO:0002683	0.397	negative regulation of immune system process
GO:0046649	0.396	lymphocyte activation
GO:0050672	0.386	negative regulation of lymphocyte proliferation
GO:0032943	0.363	mononuclear cell proliferation
GO:0046651	0.353	lymphocyte proliferation
GO:0031323	0.328	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005829	0.962	cytosol
GO:0043228	0.785	non-membrane-bounded organelle
GO:0043232	0.782	intracellular non-membrane-bounded organelle
GO:0031981	0.534	nuclear lumen
GO:0071944	0.502	cell periphery
GO:0005886	0.449	plasma membrane
GO:0005856	0.316	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]