StarFunc result for job id Q8WWX0

User Input

>input (329 residues)
MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACAR
TLLEAGANVNAITIDGVTPLFNACSQGSPSCAELLLEYGAKAQLESCLPSPTHEAASKGH
HECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGADVQKGKYWDTPLHAA
AQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
IRSYIGKPRLHLIPQLQLPTLLKNFLQYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWX0	1.000	1.000	4.205E-46	329	1.000	1.000	Q8WWX0.pdb.gz	ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens OX=9606 GN=ASB5 PE=2 SV=1
2	AFDB:Q8WXH4	0.797	0.811	6.193E-30	323	0.532	0.542	Q8WXH4.pdb.gz	ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens OX=9606 GN=ASB11 PE=1 SV=1
3	AFDB:Q91ZT8	0.777	0.878	9.559E-24	290	0.410	0.466	Q91ZT8.pdb.gz	ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus OX=10090 GN=Asb9 PE=1 SV=2
4	AFDB:Q96DX5	0.761	0.849	4.461E-23	294	0.413	0.463	Q96DX5.pdb.gz	ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens OX=9606 GN=ASB9 PE=1 SV=1
5	PDB:6v9hC	0.755	0.912	6.587E-23	270	0.413	0.504	6v9hC.pdb.gz
6	AFDB:Q503N0	0.756	0.791	2.691E-22	314	0.401	0.420	Q503N0.pdb.gz
7	AFDB:Q8WXK3	0.765	0.899	4.021E-20	278	0.343	0.406	Q8WXK3.pdb.gz	ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens OX=9606 GN=ASB13 PE=1 SV=2
8	AFDB:Q9WV74	0.693	0.679	3.876E-14	336	0.258	0.253	Q9WV74.pdb.gz	ASB1_MOUSE Ankyrin repeat and SOCS box protein 1 OS=Mus musculus OX=10090 GN=Asb1 PE=2 SV=1
9	PDB:8cs9A	0.648	0.274	7.784E-13	796	0.252	0.104	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
10	AFDB:Q9H672	0.490	0.504	8.811E-13	318	0.237	0.245	Q9H672.pdb.gz	ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens OX=9606 GN=ASB7 PE=1 SV=2
11	AFDB:Q8WXI3	0.608	0.435	1.091E-12	467	0.292	0.206	Q8WXI3.pdb.gz	ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens OX=9606 GN=ASB10 PE=1 SV=2
12	AFDB:Q9H9B1	0.511	0.148	1.241E-12	1298	0.210	0.053	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
13	PDB:2dvwA	0.601	0.849	5.200E-10	229	0.182	0.262	2dvwA.pdb.gz
14	PDB:4oauC	0.582	0.294	5.472E-9	692	0.204	0.097	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6aunA	0.410	0.254	1.528E-8	618	0.204	0.108	6aunA.pdb.gz
16	PDB:6jd6B	0.268	0.450	3.055E-7	192	0.164	0.281	6jd6B.pdb.gz
17	PDB:5vkqA	0.440	0.125	3.189E-7	1499	0.198	0.043	5vkqA.pdb.gz
18	PDB:1wg0A	0.582	0.768	1.309E-6	243	0.164	0.222	1wg0A.pdb.gz
19	PDB:6mwqA	0.353	0.249	9.370E-6	493	0.155	0.103	6mwqA.pdb.gz
20	PDB:6pqpA	0.471	0.260	1.377E-5	615	0.155	0.083	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WWX0	0.0	679	329	1.000	1.000	ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens OX=9606 GN=ASB5 PE=2 SV=1
2	Q8WXH4	2.24e-122	356	323	0.532	0.542	ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens OX=9606 GN=ASB11 PE=1 SV=1
3	Q96DX5	5.58e-88	267	294	0.416	0.466	ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens OX=9606 GN=ASB9 PE=1 SV=1
4	Q91ZT8	5.92e-83	254	290	0.410	0.466	ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus OX=10090 GN=Asb9 PE=1 SV=2
5	Q70X92	1.58e-75	236	293	0.398	0.447	Q70X92_DANRE Ankyrin repeat and SOCS box containing protein a OS=Danio rerio OX=7955 GN=asb-a PE=2 SV=1
6	Q8WXK3	2.93e-64	206	278	0.334	0.396	ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens OX=9606 GN=ASB13 PE=1 SV=2
7	Q17490	5.52e-27	114	6994	0.255	0.012	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
8	G5ECZ1	1.75e-26	112	1867	0.252	0.044	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
9	Q8MQG0	2.00e-26	112	1841	0.252	0.045	Q8MQG0_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
10	P16157	2.02e-24	106	1881	0.234	0.041	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
11	X2JCM1	3.33e-24	105	11634	0.234	0.007	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	M9MRX4	3.34e-24	105	13559	0.234	0.006	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	M9MSK6	7.90e-24	104	4352	0.234	0.018	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	A8JNM6	8.03e-24	104	4189	0.234	0.018	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	M9MRR4	8.03e-24	104	4223	0.234	0.018	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	M9MS19	8.03e-24	104	4230	0.234	0.018	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	M9MRX1	8.05e-24	104	4329	0.234	0.018	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	A8JNM7	8.25e-24	104	4114	0.234	0.019	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	Q7KU92	8.25e-24	104	4083	0.234	0.019	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
20	A8JNM5	1.12e-23	104	4264	0.234	0.018	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.7e-24	96.4	Ankyrin repeat
2	PF12796 Ank_2	1.8e-30	116.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.4e-27	102.8	Ankyrin repeat
4	PF13637 Ank_4	5.8e-28	108.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.2e-16	71.0	Ankyrin repeats (many copies)
6	PF07525 SOCS_box	9e-07	40.4	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296525

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.754	Cullin-5
2	9606.ENSP00000262306	0.702	Elongin-B
3	9606.ENSP00000478121	0.692	Elongin-C
4	9606.ENSP00000250495	0.655	NEDD8
5	9606.ENSP00000361811	0.632	TP53-target gene 5 protein
6	9606.ENSP00000280190	0.603	WD repeat-containing protein 17
7	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
8	9606.ENSP00000267935	0.600	COMM domain-containing protein 4
9	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
10	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
11	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
12	9606.ENSP00000348054	0.600	COMM domain containing 6
13	9606.ENSP00000365401	0.600	Coiled-coil domain-containing protein 22
14	9606.ENSP00000366032	0.600	COMM domain-containing protein 3
15	9606.ENSP00000368908	0.600	LHFPL tetraspan subfamily member 6 protein
16	9606.ENSP00000370984	0.600	COMM domain-containing protein 8
17	9606.ENSP00000394331	0.600	COMM domain-containing protein 5
18	9606.ENSP00000419475	0.600	COMM domain-containing protein 2
19	9606.ENSP00000273480	0.569	RING-box protein 2
20	9606.ENSP00000277458	0.540	Ankyrin repeat and SOCS box protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.984	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0071704	0.953	organic substance metabolic process
GO:0044238	0.948	primary metabolic process
GO:0006807	0.880	nitrogen compound metabolic process
GO:0043170	0.833	macromolecule metabolic process
GO:1901564	0.704	organonitrogen compound metabolic process
GO:0019538	0.682	protein metabolic process
GO:0044237	0.463	cellular metabolic process
GO:0019222	0.454	regulation of metabolic process
GO:0051171	0.433	regulation of nitrogen compound metabolic process
GO:0080090	0.432	regulation of primary metabolic process
GO:0060255	0.432	regulation of macromolecule metabolic process
GO:0048518	0.431	positive regulation of biological process
GO:0050896	0.370	response to stimulus
GO:0036211	0.320	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.959	membrane-bounded organelle
GO:0043229	0.953	intracellular organelle
GO:0043231	0.909	intracellular membrane-bounded organelle
GO:0005634	0.702	nucleus
GO:0012505	0.404	endomembrane system
GO:0070013	0.368	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]