StarFunc result for job id Q8WWY6

User Input

>input (194 residues)
MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLE
KPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMP
HLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANE
AEKVRDQEGRPEKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWY6	1.000	1.000	2.317E-33	194	1.000	1.000	Q8WWY6.pdb.gz	MB3L1_HUMAN Methyl-CpG-binding domain protein 3-like 1 OS=Homo sapiens OX=9606 GN=MBD3L1 PE=1 SV=2
2	AFDB:F7EY92	0.278	0.216	2.929E-9	254	0.412	0.315	F7EY92.pdb.gz	F7EY92_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=3
3	AFDB:O95983	0.282	0.194	1.400E-8	291	0.418	0.278	O95983.pdb.gz	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
4	AFDB:Q9Z2E1	0.248	0.129	1.967E-8	414	0.387	0.181	Q9Z2E1.pdb.gz	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
5	AFDB:A6NE82	0.226	0.212	8.782E-8	208	0.402	0.375	A6NE82.pdb.gz	MB3L3_HUMAN Putative methyl-CpG-binding domain protein 3-like 3 OS=Homo sapiens OX=9606 GN=MBD3L3 PE=5 SV=1
6	AFDB:Q8CFU8	0.179	0.161	7.593E-2	221	0.160	0.140	Q8CFU8.pdb.gz	T53I2_MOUSE Tumor protein p53-inducible nuclear protein 2 OS=Mus musculus OX=10090 GN=Tp53inp2 PE=2 SV=4
7	AFDB:Q86UE8	0.171	0.050	1.604E-1	772	0.170	0.043	Q86UE8.pdb.gz	TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 PE=1 SV=2
8	AFDB:A0A1D8PJR1	0.194	0.071	2.254E-1	619	0.155	0.048	A0A1D8PJR1.pdb.gz	A0A1D8PJR1_CANAL Uso5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=USO5 PE=4 SV=1
9	AFDB:A7T4J9	0.179	0.162	2.765E-1	217	0.134	0.120	A7T4J9.pdb.gz	A7T4J9_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g248713 PE=1 SV=1
10	AFDB:A0A287BDC1	0.176	0.169	3.629E-1	203	0.196	0.187	A0A287BDC1.pdb.gz	AKIR2_PIG Akirin-2 OS=Sus scrofa OX=9823 GN=AKIRIN2 PE=2 SV=2
11	PDB:7pzyt	0.114	0.119	1.105	200	0.160	0.155	7pzyt.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
12	PDB:7odrl	0.095	0.131	1.779	82	0.062	0.146	7odrl.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
13	PDB:7wtxt	0.205	0.299	1.904	132	0.124	0.182	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
14	PDB:4v6wCW	0.177	0.253	2.499	130	0.088	0.131	4v6wCW.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:7ungi	0.162	0.139	3.064	250	0.134	0.104	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:5ganG	0.126	0.082	3.280	318	0.088	0.053	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
17	PDB:6ff4C	0.169	0.120	3.511	286	0.082	0.056	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7r5jC0	0.112	0.019	3.758	2011	0.036	0.003	7r5jC0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:2p01A	0.166	0.103	4.306	323	0.124	0.074	2p01A.pdb.gz
20	PDB:7os2C	0.090	0.171	4.306	54	0.072	0.259	7os2C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WWY6	8.44e-144	399	194	1.000	1.000	MB3L1_HUMAN Methyl-CpG-binding domain protein 3-like 1 OS=Homo sapiens OX=9606 GN=MBD3L1 PE=1 SV=2
2	O95983	1.20e-44	151	291	0.438	0.292	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
3	A0A8I6GL26	8.22e-44	148	262	0.428	0.317	A0A8I6GL26_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
4	A0A8I6ANN7	8.28e-44	148	257	0.428	0.323	A0A8I6ANN7_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
5	Q9Z2D8	2.39e-43	148	285	0.428	0.291	MBD3_MOUSE Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1
6	B2RZ64	4.70e-43	147	308	0.428	0.269	B2RZ64_RAT Mbd3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=2 SV=1
7	Q7ZZR0	4.61e-41	140	242	0.407	0.326	Q7ZZR0_DANRE Mbd3b protein OS=Danio rerio OX=7955 GN=mdb3b PE=1 SV=1
8	A0A2R8QPC3	1.12e-40	140	265	0.407	0.298	A0A2R8QPC3_DANRE Methyl-CpG binding domain protein 3b isoform X1 OS=Danio rerio OX=7955 GN=cb357 PE=1 SV=1
9	F7EY92	8.44e-38	133	282	0.381	0.262	F7EY92_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=3
10	Q9UBB5	2.91e-37	135	411	0.392	0.185	MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
11	Q9Z2E1	6.36e-37	134	414	0.392	0.184	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
12	B0BNM2	1.86e-36	133	412	0.381	0.180	B0BNM2_RAT Mbd2 protein OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=2 SV=1
13	D4A986	2.32e-36	132	412	0.381	0.180	D4A986_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=3
14	A6NE82	8.14e-31	113	208	0.387	0.361	MB3L3_HUMAN Putative methyl-CpG-binding domain protein 3-like 3 OS=Homo sapiens OX=9606 GN=MBD3L3 PE=5 SV=1
15	Q8NHZ7	1.62e-30	112	208	0.387	0.361	MB3L2_HUMAN Methyl-CpG-binding domain protein 3-like 2 OS=Homo sapiens OX=9606 GN=MBD3L2 PE=1 SV=3
16	Q9V424	5.08e-12	64.3	226	0.227	0.195	Q9V424_DROME Methyl-CpG binding domain protein-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
17	Q9VHB7	1.38e-11	64.3	339	0.227	0.130	Q9VHB7_DROME LD22928p OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=2
18	A0A0B4KGZ0	1.46e-11	64.3	340	0.227	0.129	A0A0B4KGZ0_DROME Methyl-CpG binding domain protein-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
19	A0A8I5ZWB0	0.063	36.2	2238	0.124	0.011	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
20	B3DHH5	1.6	29.6	72	0.093	0.250	SMIM1_DANRE Small integral membrane protein 1 OS=Danio rerio OX=7955 GN=smim1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16564 MBDa	2e-28	109.7	p55-binding region of Methyl-CpG-binding domain proteins MBD
2	PF14048 MBD_C	3.3e-23	93.5	C-terminal domain of methyl-CpG binding protein 2 and 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471575

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362592	0.927	Histone-binding protein RBBP4
2	9606.ENSP00000333633	0.925	Metastasis-associated protein MTA1
3	9606.ENSP00000362649	0.917	Histone deacetylase 1
4	9606.ENSP00000353463	0.902	Transcriptional repressor p66-alpha
5	9606.ENSP00000369716	0.900	Chromodomain-helicase-DNA-binding protein 3
6	9606.ENSP00000369424	0.885	Histone-binding protein RBBP7
7	9606.ENSP00000278823	0.866	Metastasis-associated protein MTA2
8	9606.ENSP00000383973	0.860	Metastasis-associated protein MTA3
9	9606.ENSP00000357644	0.855	Transcriptional repressor p66-beta
10	9606.ENSP00000349508	0.852	Chromodomain-helicase-DNA-binding protein 4
11	9606.ENSP00000338774	0.836	B-cell lymphoma/leukemia 11A
12	9606.ENSP00000430432	0.830	Histone deacetylase 2
13	9606.ENSP00000261692	0.796	Cyclin-dependent kinase 2-associated protein 1
14	9606.ENSP00000354206	0.794	Zinc finger protein 219
15	9606.ENSP00000354794	0.757	Zinc finger protein 521
16	9606.ENSP00000455426	0.755	Zinc finger protein 423
17	9606.ENSP00000316284	0.720	Olfactory receptor 2Z1
18	9606.ENSP00000323183	0.705	Zinc finger and BTB domain-containing protein 2
19	9606.ENSP00000345773	0.690	BEN domain containing 7
20	9606.ENSP00000395535	0.627	Methyl-CpG-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.617	heterocyclic compound binding
GO:0097159	0.617	organic cyclic compound binding
GO:0003677	0.605	DNA binding
GO:0043565	0.410	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0019222	0.957	regulation of metabolic process
GO:0060255	0.891	regulation of macromolecule metabolic process
GO:0071840	0.772	cellular component organization or biogenesis
GO:0016043	0.761	cellular component organization
GO:0048519	0.749	negative regulation of biological process
GO:0050794	0.713	regulation of cellular process
GO:0080090	0.679	regulation of primary metabolic process
GO:0051171	0.679	regulation of nitrogen compound metabolic process
GO:0031323	0.662	regulation of cellular metabolic process
GO:0019219	0.589	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.578	organic substance metabolic process
GO:0010468	0.556	regulation of gene expression
GO:0009892	0.545	negative regulation of metabolic process
GO:0010605	0.505	negative regulation of macromolecule metabolic process
GO:0051252	0.505	regulation of RNA metabolic process
GO:0006355	0.503	regulation of DNA-templated transcription
GO:0006807	0.490	nitrogen compound metabolic process
GO:0044238	0.489	primary metabolic process
GO:0048523	0.454	negative regulation of cellular process
GO:0006325	0.409	chromatin organization
GO:0043170	0.397	macromolecule metabolic process
GO:0010558	0.385	negative regulation of macromolecule biosynthetic process
GO:0045934	0.385	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.384	negative regulation of cellular biosynthetic process
GO:0045892	0.357	negative regulation of DNA-templated transcription
GO:0006338	0.318	chromatin remodeling
GO:0032502	0.311	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005654	0.996	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0000785	0.988	chromatin
GO:1902494	0.981	catalytic complex
GO:0140513	0.978	nuclear protein-containing complex
GO:0000118	0.967	histone deacetylase complex
GO:0070603	0.919	SWI/SNF superfamily-type complex
GO:0005667	0.819	transcription regulator complex
GO:0016581	0.805	NuRD complex
GO:0005737	0.476	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]