StarFunc result for job id Q8WWZ1

User Input

>input (152 residues)
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLG
IQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGW
FLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WWZ1	1.000	1.000	7.477E-29	152	1.000	1.000	Q8WWZ1.pdb.gz	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
2	PDB:5bowA	0.975	0.981	2.227E-26	151	0.974	0.980	5bowA.pdb.gz
3	AFDB:Q9QYY1	0.871	0.850	9.880E-15	156	0.454	0.442	Q9QYY1.pdb.gz	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
4	PDB:1md6A	0.852	0.842	5.021E-14	154	0.434	0.429	1md6A.pdb.gz
5	AFDB:P25086	0.839	0.724	5.790E-13	178	0.375	0.320	P25086.pdb.gz	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
6	AFDB:P18510	0.839	0.728	6.427E-13	177	0.375	0.322	P18510.pdb.gz	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
7	AFDB:P25085	0.811	0.701	1.825E-12	178	0.395	0.337	P25085.pdb.gz	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
8	AFDB:Q9UHA7	0.880	0.849	1.076E-11	158	0.276	0.266	Q9UHA7.pdb.gz	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1
9	AFDB:Q9NZH6	0.856	0.609	1.326E-11	218	0.303	0.211	Q9NZH6.pdb.gz	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
10	AFDB:Q9D6Z6	0.871	0.733	2.614E-11	183	0.270	0.224	Q9D6Z6.pdb.gz	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
11	AFDB:Q8R460	0.835	0.777	4.642E-11	164	0.243	0.226	Q8R460.pdb.gz	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
12	PDB:4izeA	0.830	0.830	2.239E-10	152	0.283	0.283	4izeA.pdb.gz
13	AFDB:A3DTN4	0.708	0.422	3.201E-10	269	0.322	0.182	A3DTN4.pdb.gz	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
14	PDB:6hpiA	0.745	0.721	3.206E-9	158	0.270	0.259	6hpiA.pdb.gz
15	PDB:1irpA	0.695	0.691	1.703E-8	153	0.375	0.373	1irpA.pdb.gz
16	PDB:3malA	0.594	0.514	6.165E-5	181	0.171	0.144	3malA.pdb.gz
17	PDB:1t9fA	0.567	0.495	1.943E-4	178	0.178	0.152	1t9fA.pdb.gz
18	PDB:3v0aB	0.615	0.098	2.273E-4	1150	0.125	0.017	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:4qd2C	0.668	0.372	7.165E-4	286	0.112	0.059	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
20	PDB:7t3rA	0.596	0.057	1.833E-3	2130	0.125	0.009	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WWZ1	1.95e-111	314	152	1.000	1.000	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
2	Q9QYY1	6.41e-35	120	156	0.454	0.442	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
3	Q9UBH0	3.59e-31	111	155	0.414	0.406	I36RA_HUMAN Interleukin-36 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL36RN PE=1 SV=1
4	P25086	9.10e-28	103	178	0.388	0.331	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
5	P25085	4.40e-27	101	178	0.388	0.331	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
6	P18510	4.96e-26	99.0	177	0.382	0.328	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
7	Q9D6Z6	9.22e-17	75.1	183	0.263	0.219	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
8	Q9NZH8	1.22e-14	69.3	169	0.283	0.254	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
9	A3DTN4	2.41e-14	70.1	269	0.243	0.138	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
10	A3DTN2	2.18e-12	64.7	267	0.237	0.135	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
11	O73909	2.18e-12	64.7	267	0.237	0.135	O73909_CHICK Interleukin-1 OS=Gallus gallus OX=9031 GN=il-1beta PE=1 SV=1
12	F4ZWC1	2.22e-12	64.7	267	0.237	0.135	F4ZWC1_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
13	E9LHC8	2.27e-12	64.7	267	0.237	0.135	E9LHC8_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
14	A3DTN3	2.46e-12	64.7	267	0.237	0.135	A3DTN3_9AVES Interleukin-1 OS=Anser anser OX=8843 PE=2 SV=1
15	A3DTN5	5.50e-12	63.5	267	0.211	0.120	A3DTN5_MELGA Interleukin-1 OS=Meleagris gallopavo OX=9103 GN=IL1RN PE=2 SV=1
16	Q9JLA2	7.82e-12	61.6	160	0.237	0.225	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
17	P26889	2.94e-11	61.6	267	0.197	0.112	IL1B_PIG Interleukin-1 beta OS=Sus scrofa OX=9823 GN=IL1B PE=1 SV=1
18	Q9NZH6	2.98e-11	61.2	218	0.237	0.165	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
19	Q8R460	1.69e-10	58.2	164	0.250	0.232	IL36G_MOUSE Interleukin-36 gamma OS=Mus musculus OX=10090 GN=Il36g PE=2 SV=1
20	Q9UHA7	9.73e-10	55.8	158	0.263	0.253	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	3.7e-15	67.0	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376893

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264257	0.996	Interleukin-1 receptor-like 2
2	9606.ENSP00000259213	0.975	Interleukin-36 beta
3	9606.ENSP00000314807	0.967	Interleukin 1 receptor accessory protein
4	9606.ENSP00000368278	0.925	Interleukin-1 receptor accessory protein-like 1
5	9606.ENSP00000259205	0.921	Interleukin-36 gamma
6	9606.ENSP00000386380	0.920	Interleukin-1 receptor type 1
7	9606.ENSP00000259211	0.918	Interleukin-36 alpha
8	9606.ENSP00000378974	0.907	Mitogen-activated protein kinase 8
9	9606.ENSP00000330878	0.829	Importin subunit alpha-8
10	9606.ENSP00000289361	0.819	Butyrophilin subfamily 3 member A1
11	9606.ENSP00000385675	0.778	Interleukin-6
12	9606.ENSP00000362728	0.764	Importin subunit alpha-7
13	9606.ENSP00000263341	0.763	Interleukin-1 beta
14	9606.ENSP00000398698	0.743	Tumor necrosis factor
15	9606.ENSP00000376896	0.727	Interleukin-36 receptor antagonist protein
16	9606.ENSP00000263339	0.680	Interleukin-1 alpha
17	9606.ENSP00000403104	0.669	Single Ig IL-1-related receptor
18	9606.ENSP00000370842	0.667	Interleukin-33
19	9606.ENSP00000361663	0.655	Interleukin 1 receptor accessory protein like 2
20	9606.ENSP00000368771	0.647	Mucin-3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0098772	0.981	molecular function regulator activity
GO:0030545	0.883	signaling receptor regulator activity
GO:0140677	0.717	molecular function activator activity
GO:0048018	0.713	receptor ligand activity
GO:0005125	0.680	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0050794	0.959	regulation of cellular process
GO:0009987	0.918	cellular process
GO:0050896	0.895	response to stimulus
GO:0048518	0.851	positive regulation of biological process
GO:0048583	0.818	regulation of response to stimulus
GO:0048519	0.815	negative regulation of biological process
GO:0023052	0.782	signaling
GO:0010468	0.761	regulation of gene expression
GO:0007154	0.720	cell communication
GO:0048522	0.631	positive regulation of cellular process
GO:0051716	0.608	cellular response to stimulus
GO:0006950	0.566	response to stress
GO:0002376	0.557	immune system process
GO:0006952	0.496	defense response
GO:0048523	0.484	negative regulation of cellular process
GO:0006955	0.474	immune response
GO:0009893	0.473	positive regulation of metabolic process
GO:0051239	0.468	regulation of multicellular organismal process
GO:0008152	0.433	metabolic process
GO:0010604	0.430	positive regulation of macromolecule metabolic process
GO:0051171	0.420	regulation of nitrogen compound metabolic process
GO:0042221	0.414	response to chemical
GO:0071704	0.381	organic substance metabolic process
GO:0080090	0.363	regulation of primary metabolic process
GO:0031323	0.362	regulation of cellular metabolic process
GO:0009605	0.359	response to external stimulus
GO:0001817	0.346	regulation of cytokine production
GO:0044419	0.342	biological process involved in interspecies interaction between organisms
GO:0009966	0.337	regulation of signal transduction
GO:0032501	0.328	multicellular organismal process
GO:0032101	0.320	regulation of response to external stimulus
GO:0070887	0.318	cellular response to chemical stimulus
GO:0009607	0.313	response to biotic stimulus
GO:0010033	0.312	response to organic substance
GO:0009892	0.303	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.695	intracellular anatomical structure
GO:0005737	0.351	cytoplasm
GO:0071944	0.311	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]