StarFunc result for job id Q8WWZ4

User Input

>input (1543 residues)
MNKMALASFMKGRTVIGTPDEETMDIELPKKYHEMVGVIFSDTFSYRLKFNWGYRIPVIK
EHSEYTEHCWAMHGEIFCYLAKYWLKGFVAFQAAINAAIIEVTTNHSVMEELTSVIGINM
KIPPFISKGEIMNEWFHFTCLVSFSSFIYFASLNVARERGKFKKLMTVMGLRESAFWLSW
GLTYICFIFIMSIFMALVITSIPIVFHTGFMVIFTLYSLYGLSLIALAFLMSVLIRKPML
AGLAGFLFTVFWGCLGFTVLYRQLPLSLGWVLSLLSPFAFTAGMAQITHLDNYLSGVIFP
DPSGDSYKMIATFFILAFDTLFYLIFTLYFERVLPDKDGHGDSPLFFLKSSFWSKHQNTH
HEIFENEINPEHSSDDSFEPVSPEFHGKEAIRIRNVIKEYNGKTGKVEALQGIFFDIYEG
QITAILGHNGAGKSTLLNILSGLSVSTEGSATIYNTQLSEITDMEEIRKNIGFCPQFNFQ
FDFLTVRENLRVFAKIKGIQPKEVEQEVKRIIMELDMQSIQDIIAKKLSGGQKRKLTLGI
AILGDPQVLLLDEPTAGLDPFSRHRVWSLLKEHKVDRLILFSTQFMDEADILADRKVFLS
NGKLKCAGSSLFLKRKWGIGYHLSLHRNEMCDTEKITSLIKQHIPDAKLTTESEEKLVYS
LPLEKTNKFPDLYSDLDKCSDQGIRNYAVSVTSLNEVFLNLEGKSAIDEPDFDIGKQEKI
HVTRNTGDESEMEQVLCSLPETRKAVSSAALWRRQIYAVATLRFLKLRRERRALLCLLLV
LGIAFIPIILEKIMYKVTRETHCWEFSPSMYFLSLEQIPKTPLTSLLIVNNTGSNIEDLV
HSLKCQDIVLEIDDFRNRNGSDDPSYNGAIIVSGDQKDYRFSVACNTKKLNCFPVLMGIV
SNALMGIFNFTELIQMESTSFSRDDIVLDLGFIDGSIFLLLITNCVSPFIGMSSISDYKK
NVQSQLWISGLWPSAYWCGQALVDIPLYFLILFSIHLIYYFIFLGFQLSWELMFVLVVCI
IGCAVSLIFLTYVLSFIFRKWRKNNGFWSFGFFIILICVSTIMVSTQYEKLNLILCMIFI
PSFTLLGYVMLLIQLDFMRNLDSLDNRINEVNKTILLTTLIPYLQSVIFLFVIRCLEMKY
GNEIMNKDPVFRISPRSRETHPNPEEPEEEDEDVQAERVQAANALTAPNLEEEPVITASC
LHKEYYETKKSCFSTRKKKIAIRNVSFCVKKGEVLGLLGHNGAGKSTSIKMITGCTKPTA
GVVVLQGSRASVRQQHDNSLKFLGYCPQENSLWPKLTMKEHLELYAAVKGLGKEDAALSI
SRLVEALKLQEQLKAPVKTLSEGIKRKLCFVLSILGNPSVVLLDEPFTGMDPEGQQQMWQ
ILQATVKNKERGTLLTTHYMSEAEAVCDRMAMMVSGTLRCIGSIQHLKNKFGRDYLLEIK
MKEPTQVEALHTEILKLFPQAAWQERYSSLMAYKLPVEDVHPLSRAFFKLEAMKQTFNLE
EYSLSQATLEQVFLELCKEQELGNVDDKIDTTVEWKLLPQEDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94911	0.957	0.912	0.000	1621	0.613	0.584	O94911.pdb.gz	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	AFDB:Q8CF82	0.926	0.872	0.000	1642	0.420	0.395	Q8CF82.pdb.gz	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	AFDB:Q8K440	0.956	0.911	0.000	1620	0.579	0.552	Q8K440.pdb.gz	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	AFDB:Q8K449	0.957	0.911	0.000	1623	0.601	0.571	Q8K449.pdb.gz	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
5	AFDB:Q8N139	0.952	0.909	0.000	1617	0.618	0.589	Q8N139.pdb.gz	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
6	AFDB:E9PWH4	0.763	0.711	1.681E-86	1668	0.250	0.231	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
7	AFDB:Q99758	0.750	0.685	1.915E-86	1704	0.262	0.237	Q99758.pdb.gz	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
8	AFDB:A0A0G2K1Q8	0.753	0.689	9.529E-86	1704	0.269	0.244	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
9	AFDB:Q9BZC7	0.769	0.508	1.985E-84	2435	0.265	0.168	Q9BZC7.pdb.gz	ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=4
10	AFDB:Q84M24	0.756	0.630	8.305E-84	1882	0.261	0.214	Q84M24.pdb.gz	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
11	PDB:7w01A	0.772	0.747	1.361E-72	1598	0.260	0.251	7w01A.pdb.gz
12	PDB:7w02A	0.692	0.683	9.550E-71	1566	0.251	0.248	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
13	PDB:7lkzA	0.697	0.572	2.906E-66	1920	0.239	0.192	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
14	PDB:7tbwA	0.688	0.563	2.773E-65	1928	0.254	0.203	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
15	PDB:7e7qA	0.676	0.547	4.051E-62	1958	0.237	0.186	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
16	PDB:7tbyA	0.683	0.596	5.986E-62	1788	0.238	0.206	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
17	PDB:7e7iA	0.700	0.549	7.408E-61	2011	0.240	0.184	7e7iA.pdb.gz
18	PDB:7roqA	0.622	0.531	8.900E-52	1831	0.215	0.181	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
19	PDB:7m1pA	0.650	0.529	2.197E-49	1938	0.226	0.180	7m1pA.pdb.gz
20	PDB:7m1qA	0.634	0.522	7.502E-41	1911	0.218	0.176	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94911	0.0	1863	1621	0.614	0.584	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	Q8CF82	0.0	1187	1642	0.430	0.404	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	Q8K440	0.0	1765	1620	0.588	0.560	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	Q8K448	0.0	1189	1642	0.434	0.407	ABCA5_MOUSE Cholesterol transporter ABCA5 OS=Mus musculus OX=10090 GN=Abca5 PE=1 SV=2
5	Q8K449	0.0	1830	1623	0.601	0.571	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
6	Q8N139	0.0	1878	1617	0.621	0.592	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
7	Q8WWZ7	0.0	1209	1642	0.434	0.408	ABCA5_HUMAN Cholesterol transporter ABCA5 OS=Homo sapiens OX=9606 GN=ABCA5 PE=1 SV=2
8	Q6XBG2	1.72e-150	503	1668	0.280	0.259	Q6XBG2_MOUSE ATP-binding cassette transporter sub-family A member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
9	E9PWH4	3.35e-150	503	1668	0.280	0.259	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
10	Q8T6J2	3.54e-128	440	1662	0.253	0.235	ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcA5 PE=3 SV=1
11	Q54BT5	1.08e-127	439	1702	0.258	0.234	ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcA3 PE=3 SV=1
12	Q385F7	1.20e-126	437	1738	0.251	0.223	Q385F7_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3950 PE=4 SV=1
13	Q8T6J1	1.04e-120	418	1631	0.248	0.235	ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum OX=44689 GN=abcA6 PE=3 SV=1
14	A0A0G2K1Q8	2.66e-96	346	1704	0.141	0.127	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
15	Q8R420	3.98e-94	339	1704	0.138	0.125	ABCA3_MOUSE Phospholipid-transporting ATPase ABCA3 OS=Mus musculus OX=10090 GN=Abca3 PE=1 SV=3
16	C0P274	4.24e-93	336	1758	0.251	0.220	C0P274_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=1
17	P34358	2.21e-92	333	1704	0.206	0.187	CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=6
18	Q99758	1.42e-89	325	1704	0.135	0.122	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
19	O95477	2.65e-82	303	2261	0.152	0.103	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
20	F1LNL3	2.74e-82	303	2201	0.136	0.095	F1LNL3_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	8.3e+02	10.0	AAA domain
2	PF13175 AAA_15	2.1	19.4	AAA ATPase domain
3	PF13191 AAA_16	26	16.6	AAA ATPase domain
4	PF13304 AAA_21	2e-15	69.0	AAA domain, putative AbiEii toxin, Type IV TA system
5	PF13401 AAA_22	7e+02	11.9	AAA domain
6	PF13476 AAA_23	0.32	23.0	AAA domain
7	PF13479 AAA_24	49	15.1	AAA domain
8	PF13514 AAA_27	5.9e+02	11.4	AAA domain
9	PF13555 AAA_29	0.18	22.9	P-loop containing region of AAA domain
10	PF13604 AAA_30	1.1e+02	13.9	AAA domain
11	PF01061 ABC2_membrane	0.099	23.6	ABC-2 type transporter
12	PF12698 ABC2_membrane_3	4.7e-28	109.9	ABC-2 family transporter protein
13	PF00005 ABC_tran	6.8e-60	213.0	ABC transporter
14	PF00006 ATP-synt_ab	5.1	18.2	ATP synthase alpha/beta family, nucleotide-binding domain
15	PF00350 Dynamin_N	1.8e+02	13.6	Dynamin family
16	PF01926 MMR_HSR1	2.5	19.6	50S ribosome-binding GTPase
17	PF04310 MukB	7.5e+02	11.2	MukB N-terminal
18	PF03193 RsgA_GTPase	0.001	30.5	RsgA GTPase
19	PF13558 SbcC_Walker_B	1.8	20.2	SbcC/RAD50-like, Walker B motif
20	PF02463 SMC_N	0.47	21.4	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269081

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261200	0.637	ATP-binding cassette sub-family C member 9
2	9606.ENSP00000468348	0.603	Dual specificity mitogen-activated protein kinase kinase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042626	0.995	ATPase-coupled transmembrane transporter activity
GO:0005488	0.987	binding
GO:0042910	0.957	xenobiotic transmembrane transporter activity
GO:0008559	0.939	ABC-type xenobiotic transporter activity
GO:0005515	0.929	protein binding
GO:0005319	0.782	lipid transporter activity
GO:0016462	0.679	pyrophosphatase activity
GO:0017111	0.674	ribonucleoside triphosphate phosphatase activity
GO:0140326	0.426	ATPase-coupled intramembrane lipid transporter activity
GO:0005548	0.408	phospholipid transporter activity
GO:0015318	0.320	inorganic molecular entity transmembrane transporter activity
GO:0022890	0.306	inorganic cation transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.996	transport
GO:0065007	0.988	biological regulation
GO:0009987	0.984	cellular process
GO:0008152	0.974	metabolic process
GO:0015850	0.965	organic hydroxy compound transport
GO:0032371	0.957	regulation of sterol transport
GO:0006869	0.956	lipid transport
GO:0071704	0.901	organic substance metabolic process
GO:0044238	0.846	primary metabolic process
GO:0032374	0.790	regulation of cholesterol transport
GO:0010874	0.700	regulation of cholesterol efflux
GO:0044237	0.598	cellular metabolic process
GO:0015918	0.575	sterol transport
GO:0006629	0.499	lipid metabolic process
GO:0006807	0.491	nitrogen compound metabolic process
GO:0030301	0.488	cholesterol transport
GO:0055085	0.364	transmembrane transport
GO:0048518	0.333	positive regulation of biological process
GO:1901564	0.323	organonitrogen compound metabolic process
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0031974	0.988	membrane-enclosed lumen
GO:0012505	0.981	endomembrane system
GO:0070013	0.957	intracellular organelle lumen
GO:0005634	0.941	nucleus
GO:0031981	0.882	nuclear lumen
GO:0005654	0.827	nucleoplasm
GO:0031090	0.537	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.995	Translocases.
EC:7.6.2.2	0.939	ABC-type xenobiotic transporter.
EC:3.6.1.-	0.679	In phosphorus-containing anhydrides.
RHEA:23680	0.674	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.674	nucleoside-triphosphate phosphatase.
EC:7.6.2.1	0.426	P-type phospholipid transporter.

[back to server]