StarFunc result for job id Q8WWZ7

User Input

>input (1642 residues)
MSTAIREVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFWLILISMMHPNKKYEE
VPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSL
SKPSNFVGVVFKDSMSYELRFFPDMIPVSSIYMDSRAGCSKSCEAAQYWSSGFTVLQASI
DAAIIQLKTNVSLWKELESTKAVIMGETAVVEIDTFPRGVILIYLVIAFSPFGYFLAIHI
VAEKEKKIKEFLKIMGLHDTAFWLSWVLLYTSLIFLMSLLMAVIATASLLFPQSSSIVIF
LLFFLYGLSSVFFALMLTPLFKKSKHVGIVEFFVTVAFGFIGLMIILIESFPKSLVWLFS
PFCHCTFVIGIAQVMHLEDFNEGASFSNLTAGPYPLIITIIMLTLNSIFYVLLAVYLDQV
IPGEFGLRRSSLYFLKPSYWSKSKRNYEELSEGNVNGNISFSEIIEPVSSEFVGKEAIRI
SGIQKTYRKKGENVEALRNLSFDIYEGQITALLGHSGTGKSTLMNILCGLCPPSDGFASI
YGHRVSEIDEMFEARKMIGICPQLDIHFDVLTVEENLSILASIKGIPANNIIQEVQKVLL
DLDMQTIKDNQAKKLSGGQKRKLSLGIAVLGNPKILLLDEPTAGMDPCSRHIVWNLLKYR
KANRVTVFSTHFMDEADILADRKAVISQGMLKCVGSSMFLKSKWGIGYRLSMYIDKYCAT
ESLSSLVKQHIPGATLLQQNDQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTT
LEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKAALVSTMSLW
KQQMYTIAKFHFFTLKRESKSVRSVLLLLLIFFTVQIFMFLVHHSFKNAVVPIKLVPDLY
FLKPGDKPHKYKTSLLLQNSADSDISDLISFFTSQNIMVTMINDSDYVSVAPHSAALNVM
HSEKDYVFAAVFNSTMVYSLPILVNIISNYYLYHLNVTETIQIWSTPFFQEITDIVFKIE
LYFQAALLGIIVTAMPPYFAMENAENHKIKAYTQLKLSGLLPSAYWIGQAVVDIPLFFII
LILMLGSLLAFHYGLYFYTVKFLAVVFCLIGYVPSVILFTYIASFTFKKILNTKEFWSFI
YSVAALACIAITEITFFMGYTIATILHYAFCIIIPIYPLLGCLISFIKISWKNVRKNVDT
YNPWDRLSVAVISPYLQCVLWIFLLQYYEKKYGGRSIRKDPFFRNLSTKSKNRKLPEPPD
NEDEDEDVKAERLKVKELMGCQCCEEKPSIMVSNLHKEYDDKKDFLLSRKVKKVATKYIS
FCVKKGEILGLLGPNGAGKSTIINILVGDIEPTSGQVFLGDYSSETSEDDDSLKCMGYCP
QINPLWPDTTLQEHFEIYGAVKGMSASDMKEVISRITHALDLKEHLQKTVKKLPAGIKRK
LCFALSMLGNPQITLLDEPSTGMDPKAKQHMWRAIRTAFKNRKRAAILTTHYMEEAEAVC
DRVAIMVSGQLRCIGTVQHLKSKFGKGYFLEIKLKDWIENLEVDRLQREIQYIFPNASRQ
ESFSSILAYKIPKEDVQSLSQSFFKLEEAKHAFAIEEYSFSQATLEQVFVELTKEQEEED
NSCGTLNSTLWWERTQEDRVVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94911	0.906	0.918	0.000	1621	0.412	0.418	O94911.pdb.gz	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	AFDB:Q8CF82	0.996	0.996	0.000	1642	0.902	0.902	Q8CF82.pdb.gz	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	AFDB:Q8K440	0.912	0.924	0.000	1620	0.414	0.419	Q8K440.pdb.gz	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	AFDB:Q8K449	0.917	0.927	0.000	1623	0.413	0.418	Q8K449.pdb.gz	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
5	AFDB:Q8N139	0.909	0.922	0.000	1617	0.403	0.409	Q8N139.pdb.gz	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
6	AFDB:Q99758	0.749	0.724	4.456E-100	1704	0.259	0.249	Q99758.pdb.gz	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
7	AFDB:A0A0G2K1Q8	0.757	0.732	1.356E-99	1704	0.268	0.258	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
8	AFDB:Q84M24	0.781	0.689	4.512E-99	1882	0.276	0.241	Q84M24.pdb.gz	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
9	AFDB:E9PWH4	0.757	0.747	6.735E-99	1668	0.264	0.260	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
10	AFDB:Q8T6J1	0.737	0.742	7.129E-98	1631	0.259	0.261	Q8T6J1.pdb.gz	ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum OX=44689 GN=abcA6 PE=3 SV=1
11	PDB:7w01A	0.813	0.834	7.108E-83	1598	0.258	0.265	7w01A.pdb.gz
12	PDB:7w02A	0.678	0.707	5.041E-82	1566	0.252	0.264	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
13	PDB:7lkzA	0.689	0.599	1.673E-74	1920	0.240	0.205	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
14	PDB:7tbwA	0.680	0.589	6.733E-73	1928	0.260	0.221	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
15	PDB:7e7qA	0.652	0.558	7.489E-68	1958	0.236	0.198	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
16	PDB:7tbyA	0.714	0.659	1.069E-67	1788	0.247	0.227	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
17	PDB:7e7iA	0.680	0.565	3.113E-67	2011	0.237	0.193	7e7iA.pdb.gz
18	PDB:7roqA	0.628	0.567	1.323E-57	1831	0.201	0.180	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
19	PDB:7m1pA	0.625	0.538	6.161E-55	1938	0.228	0.193	7m1pA.pdb.gz
20	PDB:7m1qA	0.621	0.541	1.497E-47	1911	0.217	0.186	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94911	0.0	1214	1621	0.417	0.422	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	Q8CF82	0.0	3040	1642	0.903	0.903	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	Q8K440	0.0	1183	1620	0.417	0.423	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	Q8K448	0.0	3010	1642	0.901	0.901	ABCA5_MOUSE Cholesterol transporter ABCA5 OS=Mus musculus OX=10090 GN=Abca5 PE=1 SV=2
5	Q8K449	0.0	1167	1623	0.423	0.428	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
6	Q8N139	0.0	1156	1617	0.419	0.425	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
7	Q8WWZ7	0.0	3381	1642	1.000	1.000	ABCA5_HUMAN Cholesterol transporter ABCA5 OS=Homo sapiens OX=9606 GN=ABCA5 PE=1 SV=2
8	Q6XBG2	2.09e-162	539	1668	0.258	0.254	Q6XBG2_MOUSE ATP-binding cassette transporter sub-family A member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
9	E9PWH4	3.25e-162	538	1668	0.258	0.254	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
10	Q555Z5	4.64e-150	503	1615	0.278	0.283	ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcA4 PE=3 SV=1
11	Q385F7	3.04e-147	498	1738	0.240	0.227	Q385F7_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3950 PE=4 SV=1
12	E9PX95	4.25e-147	497	1733	0.286	0.271	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
13	Q8T6J1	7.56e-141	478	1631	0.267	0.269	ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum OX=44689 GN=abcA6 PE=3 SV=1
14	Q8T6J2	1.24e-139	475	1662	0.267	0.264	ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcA5 PE=3 SV=1
15	Q54BT5	8.87e-138	470	1702	0.281	0.271	ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcA3 PE=3 SV=1
16	C0P274	6.20e-102	364	1758	0.231	0.216	C0P274_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=1
17	Q8R420	2.46e-101	362	1704	0.158	0.153	ABCA3_MOUSE Phospholipid-transporting ATPase ABCA3 OS=Mus musculus OX=10090 GN=Abca3 PE=1 SV=3
18	A0A0G2K1Q8	6.91e-101	361	1704	0.132	0.127	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
19	Q99758	4.01e-100	358	1704	0.153	0.148	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
20	P34358	6.18e-100	358	1704	0.231	0.222	CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=6

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	5.1e+02	12.5	ATPase family associated with various cellular activities (AAA)
2	PF13175 AAA_15	5.3e+02	11.5	AAA ATPase domain
3	PF13191 AAA_16	0.37	22.6	AAA ATPase domain
4	PF13238 AAA_18	6.8e+02	12.2	AAA domain
5	PF13304 AAA_21	1.1e-12	59.9	AAA domain, putative AbiEii toxin, Type IV TA system
6	PF13401 AAA_22	2.1e+02	13.6	AAA domain
7	PF13476 AAA_23	0.071	25.2	AAA domain
8	PF13481 AAA_25	3.1e+02	12.3	AAA domain
9	PF13555 AAA_29	0.0026	28.8	P-loop containing region of AAA domain
10	PF13604 AAA_30	28	15.9	AAA domain
11	PF07728 AAA_5	1.3e+02	14.0	AAA domain (dynein-related subfamily)
12	PF12698 ABC2_membrane_3	2e-35	134.2	ABC-2 family transporter protein
13	PF00005 ABC_tran	4.3e-55	197.4	ABC transporter
14	PF02492 cobW	1.3e+02	13.5	CobW/HypB/UreG, nucleotide-binding domain
15	PF13732 DUF4162	4.1	19.5	Domain of unknown function (DUF4162)
16	PF19263 DUF5906	2.3e+02	14.0	Family of unknown function (DUF5906)
17	PF00350 Dynamin_N	78	14.8	Dynamin family
18	PF01078 Mg_chelatase	3.6e+02	11.9	Magnesium chelatase, subunit ChlI
19	PF01926 MMR_HSR1	0.035	25.6	50S ribosome-binding GTPase
20	PF00931 NB-ARC	24	15.6	NB-ARC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376443

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296149	0.768	Elongator complex protein 6
2	9606.ENSP00000329360	0.705	Coiled-coil domain containing 137
3	9606.ENSP00000411096	0.633	ATP binding cassette subfamily A member 13
4	9606.ENSP00000302783	0.610	Trafficking protein particle complex subunit 1
5	9606.ENSP00000448059	0.569	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
6	9606.ENSP00000349396	0.563	ATP-binding cassette sub-family D member 4
7	9606.ENSP00000352882	0.556	Plexin-A4
8	9606.ENSP00000468348	0.546	Dual specificity mitogen-activated protein kinase kinase 6
9	9606.ENSP00000411471	0.533	ATP-binding cassette sub-family F member 3
10	9606.ENSP00000368102	0.530	Coiled-coil domain-containing protein 3
11	9606.ENSP00000313603	0.526	ATP-binding cassette sub-family F member 1
12	9606.ENSP00000357588	0.525	Calcium homeostasis modulator protein 5
13	9606.ENSP00000392028	0.519	Chromodomain-helicase-DNA-binding protein 7
14	9606.ENSP00000281924	0.517	Transmembrane protein 163

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005319	0.998	lipid transporter activity
GO:0140657	0.997	ATP-dependent activity
GO:0022857	0.997	transmembrane transporter activity
GO:0042626	0.993	ATPase-coupled transmembrane transporter activity
GO:0005488	0.989	binding
GO:0003824	0.963	catalytic activity
GO:0042910	0.947	xenobiotic transmembrane transporter activity
GO:0008559	0.926	ABC-type xenobiotic transporter activity
GO:0016787	0.921	hydrolase activity
GO:0005515	0.727	protein binding
GO:0017111	0.682	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.653	ATP hydrolysis activity
GO:0005524	0.556	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.978	regulation of biological process
GO:0009987	0.969	cellular process
GO:0006810	0.964	transport
GO:0071702	0.932	organic substance transport
GO:0071704	0.915	organic substance metabolic process
GO:0006869	0.897	lipid transport
GO:0032374	0.896	regulation of cholesterol transport
GO:0010874	0.834	regulation of cholesterol efflux
GO:0044238	0.821	primary metabolic process
GO:0015850	0.814	organic hydroxy compound transport
GO:0030301	0.738	cholesterol transport
GO:0044237	0.511	cellular metabolic process
GO:0048518	0.486	positive regulation of biological process
GO:0050794	0.473	regulation of cellular process
GO:0006629	0.431	lipid metabolic process
GO:0032501	0.318	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0016020	0.969	membrane
GO:0031090	0.878	organelle membrane
GO:0005773	0.791	vacuole
GO:0000323	0.766	lytic vacuole
GO:0098588	0.737	bounding membrane of organelle
GO:0005764	0.557	lysosome
GO:0071944	0.457	cell periphery
GO:0070013	0.456	intracellular organelle lumen
GO:0005886	0.453	plasma membrane
GO:0031982	0.405	vesicle
GO:0005794	0.378	Golgi apparatus
GO:0005765	0.362	lysosomal membrane
GO:0031981	0.328	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.993	Translocases.
EC:7.6.2.2	0.926	ABC-type xenobiotic transporter.
EC:3.-.-.-	0.921	Hydrolases.
RHEA:23680	0.682	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.682	nucleoside-triphosphate phosphatase.
RHEA:13065	0.653	ATP + H2O = ADP + H(+) + phosphate

[back to server]