StarFunc result for job id Q8WX93

User Input

>input (1383 residues)
MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDS
EKEISQIFSTSPASLCEHPSHKETKLGEHASRRPQDNRSTPVQPLAEKQTKSISSPVSKR
KPAMSPLLTRPSYIRSLRKAEKRGAKTPSTNVKPKTPHQRKGGPQSQLCDKAANLIEELT
SIFKAAKPRNRSPNGESSSPDSGYLSPKNQPSALLSASASQSPMEDQGEMEREVKSPGAR
HCYQDNQDLAVPHNRKSHPQPHSALHFPAAPRFIQKLRSQEVAEGSRVYLECRVTGNPTP
RVRWFCEGKELHNTPDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLATNPSGSDTTSAEVF
IEGASSTDSDSESLAFKSRAGAMPQAQKKTTSVSLTIGSSSPKTGVTTAVIQPLSVPVQQ
VHSPTSYLCRPDGTTTAYFPPVFTKELQNTAVAEGQVVVLECRVRGAPPLQVQWFRQGSE
IQDSPDFRILQKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARNDYGSATSTAQLVVTS
ANTENCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQ
MQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTPAVLLSPTKEPPPLLAKPKLDPLKL
QQLQNQIRLEQEAGARQPPPAPRSAPPSPPFPPPPAFPELAACTPPASPEPMSALASRSA
PAMQSSGSFNYARPKQFIAAQNLGPASGHGTPASSPSSSSLPSPMSPTPRQFGRAPVPPF
AQPFGAEPEAPWGSSSPSPPPPPPPVFSPTAAFPVPDVFPLPPPPPPLPSPGQASHCSSP
ATRFGHSQTPAAFLSALLPSQPPPAAVNALGLPKGVTPAGFPKKASRTARIASDEEIQGT
KDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYK
VSSCEQRLISEIEYRLERSPVDESGDEVQYGDVPVENGMAPFFEMKLKHYKIFEGMPVTF
TCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANP
QGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQA
PGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTS
RDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGV
PPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCT
ARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVES
EDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RTX2	0.185	0.226	0.000	1106	0.798	0.997	B2RTX2.pdb.gz	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1
2	AFDB:Q8WX93	1.000	1.000	0.000	1383	1.000	1.000	Q8WX93.pdb.gz	PALLD_HUMAN Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3
3	AFDB:Q9ET54	0.245	0.241	0.000	1408	0.872	0.857	Q9ET54.pdb.gz	PALLD_MOUSE Palladin OS=Mus musculus OX=10090 GN=Palld PE=1 SV=2
4	AFDB:E7F5U2	0.089	0.059	1.236E-25	2497	0.150	0.083	E7F5U2.pdb.gz
5	AFDB:Q90X22	0.077	0.084	1.142E-23	1276	0.149	0.161	Q90X22.pdb.gz
6	AFDB:A0A2R8QRK0	0.094	0.092	9.375E-23	1420	0.105	0.102	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
7	AFDB:A0A0G2JZA1	0.087	0.082	2.037E-19	1512	0.101	0.092	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
8	PDB:6dldD	0.078	0.288	6.576E-19	269	0.045	0.230	6dldD.pdb.gz
9	PDB:5oj2B	0.082	0.123	3.936E-18	692	0.087	0.173	5oj2B.pdb.gz
10	AFDB:O55005	0.090	0.081	6.571E-18	1651	0.101	0.085	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
11	AFDB:F1R2D2	0.090	0.079	2.205E-17	1687	0.110	0.090	F1R2D2.pdb.gz
12	PDB:6dlfA	0.068	0.327	5.054E-15	236	0.035	0.208	6dlfA.pdb.gz
13	AFDB:Q8TEP8	0.092	0.061	3.315E-14	2537	0.127	0.069	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
14	PDB:1e07A	0.090	0.167	4.858E-14	642	0.069	0.150	1e07A.pdb.gz
15	PDB:6feyB	0.067	0.418	1.960E-11	207	0.033	0.217	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
16	PDB:5c6wJ	0.059	0.317	3.884E-11	238	0.025	0.143	5c6wJ.pdb.gz
17	PDB:2rcjC	0.103	0.182	8.115E-11	523	0.035	0.094	2rcjC.pdb.gz
18	PDB:1hzhH	0.060	0.167	9.503E-11	457	0.045	0.136	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
19	PDB:7sqcO0	0.090	0.105	1.526E-10	1140	0.033	0.039	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:3o3uN	0.087	0.169	5.996E-10	580	0.029	0.069	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ISX8	0.0	757	384	0.277	0.997	A0A3B3ISX8_HUMAN Palladin, cytoskeletal associated protein (Fragment) OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=1
2	B2RTX2	0.0	1334	1106	0.474	0.592	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1
3	D4A7X7	0.0	914	1298	0.424	0.452	D4A7X7_RAT Myopalladin OS=Rattus norvegicus OX=10116 GN=Mypn PE=1 SV=1
4	P0C5E3	0.0	897	603	0.318	0.730	PALLD_RAT Palladin (Fragment) OS=Rattus norvegicus OX=10116 GN=Palld PE=1 SV=1
5	Q5DTJ9	0.0	917	1315	0.427	0.449	MYPN_MOUSE Myopalladin OS=Mus musculus OX=10090 GN=Mypn PE=1 SV=2
6	Q86TC9	0.0	917	1320	0.388	0.407	MYPN_HUMAN Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2
7	Q8WX93	0.0	2838	1383	1.000	1.000	PALLD_HUMAN Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3
8	Q9ET54	0.0	2224	1408	0.870	0.854	PALLD_MOUSE Palladin OS=Mus musculus OX=10090 GN=Palld PE=1 SV=2
9	Q5M7W2	4.43e-136	422	323	0.163	0.697	Q5M7W2_RAT Similar to palladin CGI-151 protein OS=Rattus norvegicus OX=10116 GN=Palldl1 PE=2 SV=1
10	Q9UBF9	1.08e-86	294	498	0.095	0.265	MYOTI_HUMAN Myotilin OS=Homo sapiens OX=9606 GN=MYOT PE=1 SV=2
11	Q9JIF9	5.62e-84	286	496	0.093	0.258	MYOTI_MOUSE Myotilin OS=Mus musculus OX=10090 GN=Myot PE=1 SV=1
12	E7FH53	4.73e-74	259	561	0.089	0.219	E7FH53_DANRE Myotilin OS=Danio rerio OX=7955 GN=myot PE=4 SV=2
13	O97791	6.09e-60	230	2000	0.099	0.069	O97791_RABIT Titin (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=titin PE=1 SV=1
14	Q8WZ42	6.12e-58	224	34350	0.108	0.004	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
15	A2ASS6	1.60e-57	223	35213	0.108	0.004	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
16	A0A8I6A794	7.63e-56	217	5475	0.102	0.026	A0A8I6A794_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
17	A0A8I5ZUN3	8.20e-56	217	35375	0.108	0.004	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
18	A0A8I5ZU83	3.23e-55	215	26931	0.108	0.006	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	Q9I7U4	1.01e-50	201	18141	0.087	0.007	TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3
20	O01761	6.29e-34	145	8081	0.072	0.012	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.5e-13	61.9	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	9.9e-109	367.0	Immunoglobulin I-set domain
3	PF00047 ig	4.2e-48	172.8	Immunoglobulin domain
4	PF13895 Ig_2	8.9e-46	165.4	Immunoglobulin domain
5	PF13927 Ig_3	1.8e-71	248.0	Immunoglobulin domain
6	PF18452 Ig_6	0.28	22.5	Immunoglobulin domain
7	PF11465 Receptor_2B4	1.8	20.2	Natural killer cell receptor 2B4
8	PF07686 V-set	6e-18	76.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008015

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000771	0.770	LIM and SH3 protein 1
2	61853.ENSNLEP00000013329	0.725	Ezrin
3	61853.ENSNLEP00000005020	0.699	Epidermal growth factor receptor pathway substrate 8
4	61853.ENSNLEP00000013583	0.696	Uncharacterized protein
5	61853.ENSNLEP00000002679	0.692	Vasodilator stimulated phosphoprotein
6	61853.ENSNLEP00000022413	0.691	Taste receptor, type 2, member 50
7	61853.ENSNLEP00000016224	0.637	ROS proto-oncogene 1 , receptor tyrosine kinase
8	61853.ENSNLEP00000001092	0.586	Titin-cap
9	61853.ENSNLEP00000015490	0.572	Nebulette
10	61853.ENSNLEP00000008181	0.567	LIM domain containing preferred translocation partner in lipoma
11	61853.ENSNLEP00000013872	0.561	Sorbin and SH3 domain containing 2
12	61853.ENSNLEP00000015051	0.547	Ankyrin repeat domain 1 (cardiac muscle)
13	61853.ENSNLEP00000016153	0.530	Coronin, actin binding protein, 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051371	1.000	muscle alpha-actinin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0048856	0.951	anatomical structure development
GO:0032501	0.903	multicellular organismal process
GO:0030154	0.896	cell differentiation
GO:0048468	0.880	cell development
GO:0016043	0.870	cellular component organization
GO:0030029	0.852	actin filament-based process
GO:0009653	0.831	anatomical structure morphogenesis
GO:0009888	0.753	tissue development
GO:0006996	0.682	organelle organization
GO:0030036	0.670	actin cytoskeleton organization
GO:0000904	0.647	cell morphogenesis involved in differentiation
GO:0048513	0.641	animal organ development
GO:0060429	0.586	epithelium development
GO:0002064	0.556	epithelial cell development
GO:0043588	0.406	skin development
GO:0003382	0.386	epithelial cell morphogenesis
GO:0008544	0.349	epidermis development
GO:0050789	0.337	regulation of biological process
GO:0050794	0.330	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0015629	1.000	actin cytoskeleton
GO:0099512	0.999	supramolecular fiber
GO:0030055	0.997	cell-substrate junction
GO:0005925	0.993	focal adhesion
GO:0043227	0.990	membrane-bounded organelle
GO:0005886	0.986	plasma membrane
GO:0031674	0.985	I band
GO:0030018	0.958	Z disc
GO:0042641	0.952	actomyosin
GO:0097517	0.952	contractile actin filament bundle
GO:0001725	0.924	stress fiber
GO:0005829	0.862	cytosol
GO:0120025	0.812	plasma membrane bounded cell projection
GO:0031252	0.731	cell leading edge
GO:0043231	0.724	intracellular membrane-bounded organelle
GO:0030027	0.447	lamellipodium
GO:0005634	0.320	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]