StarFunc result for job id Q8WX94

User Input

>input (980 residues)
MTSPQLEWTLQTLLEQLNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVN
TSSENWIRNATVNILEEMNLTELCKMAKAEMMEDGQVQEIDNPELGDAEEDSELAKPGEK
EGWRNSMEKQSLVWKNTFWQGDIDNFHDDVTLRNQRFIPFLNPRTPRKLTPYTVVLHGPA
GVGKTTLAKKCMLDWTDCNLSPTLRYAFYLSCKELSRMGPCSFAELISKDWPELQDDIPS
ILAQAQRILFVVDGLDELKVPPGALIQDICGDWEKKKPVPVLLGSLLKRKMLPRAALLVT
TRPRALRDLQLLAQQPIYVRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLG
SAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAA
QGLWAQMSVFHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFY
ALEKEEGEDRDGHAWDIGDVQKLLSGEERLKNPDLIQVGHFLFGLANEKRAKELEATFGC
RMSPDIKQELLQCKAHLHANKPLSVTDLKEVLGCLYESQEEELAKVVVAPFKEISIHLTN
TSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDFELDIEFERCTYLTIPNWARQDLRS
LRLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDHVTRSTCHLQKVEIKNVTPDTAY
RDFCLAFIGKKTLTHLTLAGHIEWERTMMLMLCDLLRNHKCNLQYLRLGGHCATPEQWAE
FFYVLKANQSLKHLRLSANVLLDEGAMLLYKTMTRPKHFLQMLSLENCRLTEASCKDLAA
VLVVSKKLTHLCLAKNPIGDTGVKFLCEGLSYPDCKLQTLVLQQCSITKLGCRYLSEALQ
EACSLTNLDLSINQIARGLWILCQALENPNCNLKHLRLKTYETNLEIKKLLEEVKEKNPK
LTIDCNASGATAPPCCDFFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WX94	1.000	1.000	0.000	980	1.000	1.000	Q8WX94.pdb.gz	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
2	AFDB:Q9NX02	0.763	0.707	5.571E-94	1062	0.633	0.584	Q9NX02.pdb.gz	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
3	AFDB:Q86W24	0.749	0.677	3.936E-62	1093	0.361	0.324	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
4	AFDB:Q96MN2	0.474	0.468	4.338E-57	994	0.309	0.305	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
5	AFDB:D4A523	0.604	0.574	6.344E-57	1035	0.326	0.308	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
6	AFDB:Q7RTR0	0.486	0.482	7.200E-57	991	0.311	0.308	Q7RTR0.pdb.gz	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
7	AFDB:Q96P20	0.549	0.521	3.652E-55	1036	0.327	0.309	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
8	AFDB:P59046	0.619	0.579	1.889E-52	1061	0.307	0.284	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
9	AFDB:P59047	0.649	0.539	2.237E-52	1200	0.297	0.242	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
10	AFDB:Q3UWL9	0.540	0.556	7.609E-52	944	0.288	0.299	Q3UWL9.pdb.gz	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
11	PDB:7pzcA	0.670	0.653	1.502E-44	1010	0.321	0.312	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.644	0.768	2.112E-33	806	0.283	0.344	7lfhA.pdb.gz
13	PDB:6npyA	0.620	0.742	1.403E-28	798	0.254	0.312	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
14	PDB:4kxfP	0.293	0.318	6.209E-21	866	0.144	0.163	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
15	PDB:1a4yA	0.325	0.647	2.189E-16	460	0.105	0.224	1a4yA.pdb.gz
16	PDB:3jblA	0.281	0.295	4.666E-14	909	0.146	0.157	3jblA.pdb.gz
17	PDB:6b5bA	0.316	0.268	2.469E-12	1199	0.156	0.128	6b5bA.pdb.gz
18	PDB:6o60C	0.248	0.555	8.537E-9	389	0.077	0.193	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:5yudA	0.286	0.236	1.750E-8	1238	0.156	0.124	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
20	PDB:6j5wA	0.203	0.234	3.296E-8	816	0.117	0.141	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KN39	0.0	1144	1059	0.619	0.573	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
2	Q8WX94	0.0	2016	980	1.000	1.000	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
3	Q9NX02	0.0	1140	1062	0.620	0.573	NALP2_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
4	Q86W24	2.61e-173	536	1093	0.353	0.317	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
5	Q96MN2	4.31e-140	446	994	0.331	0.326	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
6	Q7RTR0	8.04e-134	429	991	0.321	0.318	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1
7	Q8R4B8	7.49e-132	425	1033	0.298	0.283	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
8	Q96P20	1.34e-130	422	1036	0.332	0.314	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
9	F1MT67	6.18e-128	416	1098	0.320	0.286	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
10	D4A523	2.79e-127	413	1035	0.290	0.274	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
11	Q647I9	1.25e-126	413	1098	0.323	0.289	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
12	P59046	3.97e-124	405	1061	0.287	0.265	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
13	Q3UWL9	8.21e-123	399	944	0.296	0.307	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
14	E9Q5R7	6.07e-121	397	1054	0.330	0.306	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
15	P59047	8.87e-118	391	1200	0.303	0.247	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
16	Q9R1M5	3.86e-110	370	1163	0.261	0.220	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
17	Q66X05	8.59e-110	364	959	0.299	0.306	NAL4F_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4f PE=1 SV=1
18	Q66X03	1.09e-103	347	949	0.285	0.294	NLR9A_MOUSE NACHT, LRR and PYD domains-containing protein 9A OS=Mus musculus OX=10090 GN=Nlrp9a PE=1 SV=1
19	Q66X22	1.32e-99	337	1003	0.292	0.285	NLR9B_MOUSE NACHT, LRR and PYD domains-containing protein 9B OS=Mus musculus OX=10090 GN=Nlrp9b PE=1 SV=1
20	Q66X01	4.70e-89	308	1004	0.282	0.275	NLR9C_MOUSE NACHT, LRR and PYD domains-containing protein 9C OS=Mus musculus OX=10090 GN=Nlrp9c PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	20	17.1	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	1.8	20.4	AAA ATPase domain
3	PF13401 AAA_22	27	16.5	AAA domain
4	PF13479 AAA_24	1.9e+02	13.2	AAA domain
5	PF13671 AAA_33	72	15.0	AAA domain
6	PF07693 KAP_NTPase	1.8e+02	12.8	KAP family P-loop domain
7	PF13516 LRR_6	0.59	21.4	Leucine Rich repeat
8	PF05729 NACHT	1.8e-38	143.6	NACHT domain
9	PF00931 NB-ARC	26	15.5	NB-ARC domain
10	PF17776 NLRC4_HD2	4.5e-17	74.3	NLRC4 helical domain HD2
11	PF17779 NOD2_WH	9.7e-11	53.1	NOD2 winged helix domain
12	PF02758 PYRIN	1.9e-16	71.3	PAAD/DAPIN/Pyrin domain
13	PF02367 TsaE	4.8e+02	12.1	Threonylcarbamoyl adenosine biosynthesis protein TsaE
14	PF13923 zf-C3HC4_2	3e+02	12.6	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000467123

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359392	0.925	KHDC3-like protein
2	9606.ENSP00000433138	0.899	Caspase-1
3	9606.ENSP00000385090	0.833	NLR family CARD domain-containing protein 4
4	9606.ENSP00000262238	0.822	Transcriptional repressor protein YY1
5	9606.ENSP00000219596	0.804	Pyrin
6	9606.ENSP00000357112	0.718	Interferon-inducible protein AIM2
7	9606.ENSP00000357113	0.661	Gamma-interferon-inducible protein 16
8	9606.ENSP00000247470	0.641	Apoptosis-associated speck-like protein containing a CARD
9	9606.ENSP00000326581	0.640	Paternally-expressed gene 3 protein
10	9606.ENSP00000280357	0.629	Interleukin-18
11	9606.ENSP00000347714	0.625	Immunoglobulin alpha Fc receptor
12	9606.ENSP00000428657	0.618	Baculoviral IAP repeat-containing protein 1
13	9606.ENSP00000263341	0.593	Interleukin-1 beta
14	9606.ENSP00000338157	0.585	Zinc finger and BTB domain-containing protein 16
15	9606.ENSP00000359384	0.578	Oocyte-expressed protein homolog
16	9606.ENSP00000379457	0.575	FAS-associated factor 1
17	9606.ENSP00000418259	0.570	ZFP57 zinc finger protein
18	9606.ENSP00000413720	0.535	Cyclin-dependent kinase inhibitor 1C
19	9606.ENSP00000376849	0.524	Caspase-5
20	9606.ENSP00000364859	0.522	Caspase recruitment domain-containing protein 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.987	protein binding
GO:0097159	0.479	organic cyclic compound binding
GO:1901363	0.477	heterocyclic compound binding
GO:0003676	0.446	nucleic acid binding
GO:0002020	0.445	protease binding
GO:0019966	0.428	interleukin-1 binding
GO:0019828	0.428	aspartic-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0001817	0.982	regulation of cytokine production
GO:0065009	0.981	regulation of molecular function
GO:0051716	0.978	cellular response to stimulus
GO:0009607	0.977	response to biotic stimulus
GO:0051246	0.973	regulation of protein metabolic process
GO:0010033	0.972	response to organic substance
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0050794	0.969	regulation of cellular process
GO:0050790	0.969	regulation of catalytic activity
GO:0032652	0.966	regulation of interleukin-1 production
GO:0044419	0.965	biological process involved in interspecies interaction between organisms
GO:0051707	0.958	response to other organism
GO:0032651	0.957	regulation of interleukin-1 beta production
GO:2000116	0.956	regulation of cysteine-type endopeptidase activity
GO:0070887	0.949	cellular response to chemical stimulus
GO:0032731	0.938	positive regulation of interleukin-1 beta production
GO:0043281	0.937	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0044092	0.923	negative regulation of molecular function
GO:0031323	0.911	regulation of cellular metabolic process
GO:0071310	0.887	cellular response to organic substance
GO:0051090	0.887	regulation of DNA-binding transcription factor activity
GO:0045862	0.879	positive regulation of proteolysis
GO:0009617	0.877	response to bacterium
GO:0048519	0.871	negative regulation of biological process
GO:0051345	0.865	positive regulation of hydrolase activity
GO:2001056	0.855	positive regulation of cysteine-type endopeptidase activity
GO:0009892	0.854	negative regulation of metabolic process
GO:0010629	0.841	negative regulation of gene expression
GO:0032088	0.805	negative regulation of NF-kappaB transcription factor activity
GO:1901700	0.794	response to oxygen-containing compound
GO:0043280	0.791	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0071216	0.760	cellular response to biotic stimulus
GO:0048522	0.730	positive regulation of cellular process
GO:1901701	0.698	cellular response to oxygen-containing compound
GO:0034097	0.673	response to cytokine
GO:0071219	0.625	cellular response to molecule of bacterial origin
GO:0051172	0.610	negative regulation of nitrogen compound metabolic process
GO:0006950	0.601	response to stress
GO:0051241	0.582	negative regulation of multicellular organismal process
GO:0071222	0.548	cellular response to lipopolysaccharide
GO:0001818	0.540	negative regulation of cytokine production
GO:0048583	0.534	regulation of response to stimulus
GO:0071345	0.524	cellular response to cytokine stimulus
GO:0006952	0.510	defense response
GO:0043086	0.504	negative regulation of catalytic activity
GO:0051248	0.456	negative regulation of protein metabolic process
GO:0098542	0.446	defense response to other organism
GO:0031347	0.402	regulation of defense response
GO:0002376	0.378	immune system process
GO:0048523	0.377	negative regulation of cellular process
GO:0032101	0.373	regulation of response to external stimulus
GO:0045861	0.357	negative regulation of proteolysis
GO:1900015	0.353	regulation of cytokine production involved in inflammatory response
GO:0032692	0.352	negative regulation of interleukin-1 production
GO:0031349	0.348	positive regulation of defense response
GO:0071704	0.332	organic substance metabolic process
GO:0032103	0.318	positive regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.979	endomembrane system
GO:0032991	0.869	protein-containing complex
GO:0005634	0.536	nucleus
GO:0005794	0.484	Golgi apparatus
GO:0071944	0.358	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]