StarFunc result for job id Q8WXA8

User Input

>input (447 residues)
MEGGWPARQSALLCLTVSLLLQGRGDAFTINCSGFDQHGVDPAVFQAVFDRKAFRPFTNY
SIPTRVNISFTLSAILGVDAQLQLLTSFLWMDLVWDNPFINWNPKECVGINKLTVLAENL
WLPDIFIVESMDVDQTPSGLTAYISSEGRIKYDKPMRVTSICNLDIFYFPFDQQNCTFTF
SSFLYTVDSMLLGMDKEVWEITDTSRKVIQTQGEWELLGINKATPKMSMGNNLYDQIMFY
VAIRRRPSLYIINLLVPSSFLVAIDALSFYLPAESENRAPFKITLLLGYNVFLLMMNDLL
PASGTPLISVYFALCLSLMVVSLLETVFITYLLHVATTQPPPMPRWLHSLLLHCTSPGRC
CPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKTQLMELWVQFSH
AMDTLLFRLYLLFMASSILTVIVLWNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXA8	1.000	1.000	2.073E-85	447	1.000	1.000	Q8WXA8.pdb.gz	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
2	AFDB:A5X5Y0	0.877	0.860	5.145E-69	456	0.754	0.739	A5X5Y0.pdb.gz	5HT3E_HUMAN 5-hydroxytryptamine receptor 3E OS=Homo sapiens OX=9606 GN=HTR3E PE=1 SV=1
3	AFDB:Q70Z44	0.678	0.669	4.828E-43	454	0.568	0.559	Q70Z44.pdb.gz	5HT3D_HUMAN 5-hydroxytryptamine receptor 3D OS=Homo sapiens OX=9606 GN=HTR3D PE=1 SV=3
4	AFDB:P46098	0.725	0.680	2.632E-40	478	0.360	0.337	P46098.pdb.gz	5HT3A_HUMAN 5-hydroxytryptamine receptor 3A OS=Homo sapiens OX=9606 GN=HTR3A PE=1 SV=1
5	AFDB:P23979	0.708	0.653	1.108E-39	487	0.349	0.320	P23979.pdb.gz	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
6	AFDB:O70212	0.710	0.650	2.150E-39	490	0.353	0.322	O70212.pdb.gz	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
7	AFDB:Q9JHJ5	0.716	0.732	4.932E-36	437	0.286	0.293	Q9JHJ5.pdb.gz	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
8	AFDB:O95264	0.696	0.704	4.585E-34	441	0.286	0.290	O95264.pdb.gz	5HT3B_HUMAN 5-hydroxytryptamine receptor 3B OS=Homo sapiens OX=9606 GN=HTR3B PE=1 SV=1
9	AFDB:E1JJR2	0.706	0.568	2.196E-32	564	0.271	0.215	E1JJR2.pdb.gz	E1JJR2_DROME Nicotinic acetylcholine receptor alpha7, isoform E OS=Drosophila melanogaster OX=7227 GN=nAChRalpha7 PE=3 SV=1
10	AFDB:Q9PTS8	0.682	0.634	2.117E-31	484	0.239	0.221	Q9PTS8.pdb.gz	ACHA9_CHICK Neuronal acetylcholine receptor subunit alpha-9 OS=Gallus gallus OX=9031 GN=CHRNA9 PE=1 SV=1
11	PDB:6i53B	0.572	0.739	1.635E-21	338	0.132	0.175	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.547	0.686	1.196E-20	349	0.125	0.160	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:4hfcA	0.500	0.689	3.359E-18	311	0.103	0.148	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
14	PDB:7kuyE	0.531	0.682	3.964E-18	338	0.148	0.195	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
15	PDB:4aq5E	0.518	0.612	5.948E-17	370	0.161	0.195	4aq5E.pdb.gz
16	PDB:2w8gC	0.404	0.799	1.899E-16	217	0.089	0.184	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
17	PDB:7l6qA	0.485	0.675	6.769E-16	311	0.116	0.167	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
18	PDB:4afhA	0.384	0.772	7.704E-15	213	0.083	0.174	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
19	PDB:6zgdA	0.456	0.668	3.491E-13	288	0.110	0.170	6zgdA.pdb.gz
20	PDB:3mdjC	0.126	0.078	1.773E-2	819	0.034	0.018	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5X5Y0	0.0	702	456	0.754	0.739	5HT3E_HUMAN 5-hydroxytryptamine receptor 3E OS=Homo sapiens OX=9606 GN=HTR3E PE=1 SV=1
2	Q8WXA8	0.0	920	447	1.000	1.000	5HT3C_HUMAN 5-hydroxytryptamine receptor 3C OS=Homo sapiens OX=9606 GN=HTR3C PE=1 SV=2
3	Q70Z44	4.39e-154	446	454	0.570	0.562	5HT3D_HUMAN 5-hydroxytryptamine receptor 3D OS=Homo sapiens OX=9606 GN=HTR3D PE=1 SV=3
4	P46098	1.14e-89	282	478	0.360	0.337	5HT3A_HUMAN 5-hydroxytryptamine receptor 3A OS=Homo sapiens OX=9606 GN=HTR3A PE=1 SV=1
5	P35563	3.95e-86	273	483	0.347	0.321	5HT3A_RAT 5-hydroxytryptamine receptor 3A OS=Rattus norvegicus OX=10116 GN=Htr3a PE=1 SV=2
6	P23979	1.19e-83	267	487	0.342	0.314	5HT3A_MOUSE 5-hydroxytryptamine receptor 3A OS=Mus musculus OX=10090 GN=Htr3a PE=1 SV=2
7	O70212	3.66e-82	263	490	0.362	0.331	5HT3A_CAVPO 5-hydroxytryptamine receptor 3A OS=Cavia porcellus OX=10141 GN=HTR3A PE=2 SV=1
8	Q9JHJ5	1.63e-60	205	437	0.289	0.295	5HT3B_MOUSE 5-hydroxytryptamine receptor 3B OS=Mus musculus OX=10090 GN=Htr3b PE=2 SV=1
9	Q9JJ16	1.12e-58	200	437	0.289	0.295	5HT3B_RAT 5-hydroxytryptamine receptor 3B OS=Rattus norvegicus OX=10116 GN=Htr3b PE=1 SV=1
10	O95264	1.77e-57	197	441	0.228	0.231	5HT3B_HUMAN 5-hydroxytryptamine receptor 3B OS=Homo sapiens OX=9606 GN=HTR3B PE=1 SV=1
11	Q9I8C7	3.49e-45	165	452	0.242	0.239	ACH10_CHICK Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1
12	Q8BMN3	4.84e-45	165	464	0.239	0.231	ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Chrnb3 PE=2 SV=1
13	P12391	2.03e-44	163	464	0.244	0.235	ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Chrnb3 PE=2 SV=1
14	Q9UGM1	6.96e-43	159	479	0.224	0.209	ACHA9_HUMAN Neuronal acetylcholine receptor subunit alpha-9 OS=Homo sapiens OX=9606 GN=CHRNA9 PE=1 SV=2
15	G3X8Z7	2.29e-42	158	479	0.204	0.190	G3X8Z7_MOUSE Cholinergic receptor, nicotinic, alpha polypeptide 9 OS=Mus musculus OX=10090 GN=Chrna9 PE=3 SV=1
16	Q9GZZ6	8.75e-42	155	450	0.224	0.222	ACH10_HUMAN Neuronal acetylcholine receptor subunit alpha-10 OS=Homo sapiens OX=9606 GN=CHRNA10 PE=1 SV=1
17	Q9PTS8	4.76e-41	154	484	0.210	0.194	ACHA9_CHICK Neuronal acetylcholine receptor subunit alpha-9 OS=Gallus gallus OX=9031 GN=CHRNA9 PE=1 SV=1
18	P43144	5.33e-41	154	479	0.201	0.188	ACHA9_RAT Neuronal acetylcholine receptor subunit alpha-9 OS=Rattus norvegicus OX=10116 GN=Chrna9 PE=1 SV=2
19	Q8R4G9	6.53e-41	154	499	0.242	0.216	ACHA3_MOUSE Neuronal acetylcholine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Chrna3 PE=2 SV=1
20	P04757	8.57e-41	154	499	0.213	0.190	ACHA3_RAT Neuronal acetylcholine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Chrna3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	2e-36	137.0	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	2.1e-13	62.5	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322617

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347754	0.868	5-hydroxytryptamine receptor 3A
2	9606.ENSP00000260191	0.841	5-hydroxytryptamine receptor 3B
3	9606.ENSP00000371929	0.810	5-hydroxytryptamine receptor 3D
4	9606.ENSP00000308820	0.654	Protein RIC-3
5	9606.ENSP00000406050	0.623	5-hydroxytryptamine receptor 3E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099589	1.000	serotonin receptor activity
GO:0099094	1.000	ligand-gated monoatomic cation channel activity
GO:0022824	1.000	transmitter-gated monoatomic ion channel activity
GO:0005515	0.999	protein binding
GO:0098960	0.988	postsynaptic neurotransmitter receptor activity
GO:0015318	0.738	inorganic molecular entity transmembrane transporter activity
GO:0099529	0.705	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.701	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005231	0.616	excitatory extracellular ligand-gated monoatomic ion channel activity
GO:0022848	0.331	acetylcholine-gated monoatomic cation-selective channel activity
GO:1901702	0.315	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042221	0.998	response to chemical
GO:0071495	0.995	cellular response to endogenous stimulus
GO:0007165	0.995	signal transduction
GO:0006810	0.993	transport
GO:1901701	0.990	cellular response to oxygen-containing compound
GO:0071417	0.989	cellular response to organonitrogen compound
GO:0007210	0.980	serotonin receptor signaling pathway
GO:0055085	0.976	transmembrane transport
GO:0098662	0.949	inorganic cation transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034702	0.998	ion channel complex
GO:0098802	0.998	plasma membrane signaling receptor complex
GO:0098878	0.988	neurotransmitter receptor complex
GO:0034703	0.985	cation channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]