StarFunc result for job id Q8WXC3

User Input

>input (89 residues)
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASY
YEDYAAELVVAVLRDMRMLEEAARLQRAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXC3	1.000	1.000	4.464E-13	89	1.000	1.000	Q8WXC3.pdb.gz	PYDC1_HUMAN Pyrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYDC1 PE=1 SV=1
2	PDB:2hm2Q	0.925	0.925	2.467E-10	89	1.000	1.000	2hm2Q.pdb.gz
3	AFDB:Q8CHK8	0.950	0.442	1.503E-8	193	0.607	0.280	Q8CHK8.pdb.gz	Q8CHK8_RAT Apoptosis-associated speck-like protein OS=Rattus norvegicus OX=10116 GN=Pycard PE=2 SV=1
4	AFDB:Q9ULZ3	0.953	0.441	3.504E-8	195	0.640	0.292	Q9ULZ3.pdb.gz	ASC_HUMAN Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens OX=9606 GN=PYCARD PE=1 SV=2
5	AFDB:Q9EPB4	0.922	0.433	1.010E-7	193	0.618	0.285	Q9EPB4.pdb.gz	ASC_MOUSE Apoptosis-associated speck-like protein containing a CARD OS=Mus musculus OX=10090 GN=Pycard PE=1 SV=1
6	PDB:2kn6A	0.907	0.430	7.280E-7	195	0.640	0.292	2kn6A.pdb.gz
7	AFDB:Q9JJ26	0.954	0.114	7.735E-6	767	0.337	0.039	Q9JJ26.pdb.gz	MEFV_MOUSE Pyrin OS=Mus musculus OX=10090 GN=Mefv PE=1 SV=2
8	AFDB:F8W6Z2	0.950	0.144	2.005E-5	601	0.348	0.052	F8W6Z2.pdb.gz	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
9	AFDB:Q9JJ25	0.952	0.117	2.005E-5	750	0.360	0.043	Q9JJ25.pdb.gz	MEFV_RAT Pyrin OS=Rattus norvegicus OX=10116 GN=Mefv PE=2 SV=2
10	AFDB:Q86W26	0.901	0.127	4.675E-5	655	0.337	0.046	Q86W26.pdb.gz	NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens OX=9606 GN=NLRP10 PE=1 SV=1
11	AFDB:O15553	0.938	0.110	6.091E-5	781	0.337	0.038	O15553.pdb.gz	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
12	PDB:7pzcA	0.864	0.084	1.524E-4	1010	0.281	0.025	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
13	AFDB:Q91WS2	0.848	0.093	1.951E-4	869	0.371	0.038	Q91WS2.pdb.gz	NLRP6_MOUSE NACHT, LRR and PYD domains-containing protein 6 OS=Mus musculus OX=10090 GN=Nlrp6 PE=1 SV=3
14	PDB:5h7nB	0.846	0.175	2.518E-3	460	0.247	0.048	5h7nB.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
15	PDB:6ndjB	0.586	0.137	2.724E-2	443	0.315	0.063	6ndjB.pdb.gz
16	PDB:5h7qA	0.694	0.147	4.047E-1	469	0.124	0.023	5h7qA.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
17	PDB:6p6cA	0.569	0.564	8.951E-1	90	0.112	0.111	6p6cA.pdb.gz
18	PDB:3j9kB	0.461	0.415	2.579	102	0.225	0.196	3j9kB.pdb.gz	Structure of the apoptosome: mechanistic insights into activation of an initiator caspase from Drosophila.
19	PDB:5dcaA	0.231	0.022	3.187	1948	0.191	0.009	5dcaA.pdb.gz
20	PDB:5y27A	0.250	0.229	3.543	98	0.146	0.133	5y27A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXC3	1.50e-58	176	89	1.000	1.000	PYDC1_HUMAN Pyrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYDC1 PE=1 SV=1
2	Q8CHK8	9.58e-30	106	193	0.607	0.280	Q8CHK8_RAT Apoptosis-associated speck-like protein OS=Rattus norvegicus OX=10116 GN=Pycard PE=2 SV=1
3	G3V8L1	1.13e-29	105	177	0.607	0.305	G3V8L1_RAT PYD and CARD domain containing OS=Rattus norvegicus OX=10116 GN=Pycard PE=1 SV=2
4	Q9EPB4	1.42e-29	105	193	0.618	0.285	ASC_MOUSE Apoptosis-associated speck-like protein containing a CARD OS=Mus musculus OX=10090 GN=Pycard PE=1 SV=1
5	Q9ULZ3	7.17e-25	94.0	195	0.640	0.292	ASC_HUMAN Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens OX=9606 GN=PYCARD PE=1 SV=2
6	F8W6Z2	2.89e-09	53.9	601	0.348	0.052	F8W6Z2_HUMAN MEFV innate immuity regulator, pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
7	O15553	5.12e-09	53.5	781	0.348	0.040	MEFV_HUMAN Pyrin OS=Homo sapiens OX=9606 GN=MEFV PE=1 SV=1
8	Q9JJ26	5.37e-09	53.5	767	0.326	0.038	MEFV_MOUSE Pyrin OS=Mus musculus OX=10090 GN=Mefv PE=1 SV=2
9	Q504J1	4.26e-08	50.8	404	0.348	0.077	CASPB_DANRE Caspase b OS=Danio rerio OX=7955 GN=caspb PE=1 SV=1
10	Q63035	2.10e-07	48.9	881	0.382	0.039	NLRP6_RAT NACHT, LRR and PYD domains-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Nlrp6 PE=1 SV=4
11	Q91WS2	2.90e-07	48.5	869	0.371	0.038	NLRP6_MOUSE NACHT, LRR and PYD domains-containing protein 6 OS=Mus musculus OX=10090 GN=Nlrp6 PE=1 SV=3
12	Q86W26	3.77e-06	45.4	655	0.337	0.046	NAL10_HUMAN NACHT, LRR and PYD domains-containing protein 10 OS=Homo sapiens OX=9606 GN=NLRP10 PE=1 SV=1
13	Q9JJ25	1.09e-04	41.2	747	0.360	0.043	MEFV_RAT Pyrin OS=Rattus norvegicus OX=10116 GN=Mefv PE=2 SV=2
14	Q96P20	1.42e-04	40.8	1036	0.315	0.027	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
15	D4A523	0.001	38.1	1035	0.315	0.027	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
16	Q8R4B8	0.001	38.5	1033	0.303	0.026	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
17	Q8WX94	0.003	37.0	980	0.236	0.021	NALP7_HUMAN NACHT, LRR and PYD domains-containing protein 7 OS=Homo sapiens OX=9606 GN=NLRP7 PE=1 SV=1
18	Q9I9N6	0.014	35.0	203	0.258	0.113	ASC_DANRE Apoptosis-associated speck-like protein containing a CARD OS=Danio rerio OX=7955 GN=pycard PE=1 SV=1
19	J3KN39	0.24	31.6	1059	0.258	0.022	J3KN39_HUMAN NACHT, LRR and PYD domains-containing protein 2 OS=Homo sapiens OX=9606 GN=NLRP2 PE=1 SV=1
20	Q96MN2	0.24	31.6	994	0.202	0.018	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02758 PYRIN	2.3e-16	71.0	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304336

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296641	0.909	Proteinase-activated receptor 3
2	9606.ENSP00000247470	0.850	Apoptosis-associated speck-like protein containing a CARD
3	9606.ENSP00000356825	0.803	Adenylate cyclase type 10
4	9606.ENSP00000483825	0.745	NF-kappa-B essential modulator
5	9606.ENSP00000321326	0.737	Proteinase-activated receptor 1
6	9606.ENSP00000359424	0.735	Inhibitor of nuclear factor kappa-B kinase subunit alpha
7	9606.ENSP00000379826	0.720	Tripartite motif-containing protein 40
8	9606.ENSP00000468263	0.720	ELKS/Rab6-interacting/CAST family member 1
9	9606.ENSP00000478516	0.652	NACHT, LRR and PYD domains-containing protein 1
10	9606.ENSP00000465213	0.650	Ribonuclease P protein subunit p29
11	9606.ENSP00000430684	0.619	Inhibitor of nuclear factor kappa-B kinase subunit beta
12	9606.ENSP00000428325	0.608	Pyrin domain-containing protein 2
13	9606.ENSP00000337383	0.601	NACHT, LRR and PYD domains-containing protein 3
14	9606.ENSP00000358417	0.529	D-3-phosphoglycerate dehydrogenase
15	9606.ENSP00000302100	0.518	Galectin-4
16	9606.ENSP00000362650	0.505	Protein SCAI
17	9606.ENSP00000355890	0.500	Bifunctional glutamate/proline--tRNA ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.702	identical protein binding
GO:0003824	0.473	catalytic activity
GO:1901363	0.390	heterocyclic compound binding
GO:0097159	0.390	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.970	regulation of cellular process
GO:0051246	0.965	regulation of protein metabolic process
GO:0050896	0.963	response to stimulus
GO:0009987	0.963	cellular process
GO:0050790	0.958	regulation of catalytic activity
GO:0010604	0.956	positive regulation of macromolecule metabolic process
GO:0010803	0.956	regulation of tumor necrosis factor-mediated signaling pathway
GO:0032731	0.948	positive regulation of interleukin-1 beta production
GO:0031323	0.933	regulation of cellular metabolic process
GO:0051090	0.914	regulation of DNA-binding transcription factor activity
GO:0051248	0.912	negative regulation of protein metabolic process
GO:0043433	0.899	negative regulation of DNA-binding transcription factor activity
GO:0006950	0.892	response to stress
GO:0009605	0.885	response to external stimulus
GO:0051716	0.885	cellular response to stimulus
GO:0031400	0.885	negative regulation of protein modification process
GO:0006469	0.883	negative regulation of protein kinase activity
GO:0002376	0.882	immune system process
GO:0045087	0.867	innate immune response
GO:0032088	0.863	negative regulation of NF-kappaB transcription factor activity
GO:0007154	0.851	cell communication
GO:0071345	0.819	cellular response to cytokine stimulus
GO:0007165	0.816	signal transduction
GO:0071356	0.745	cellular response to tumor necrosis factor
GO:0033209	0.689	tumor necrosis factor-mediated signaling pathway
GO:0001960	0.661	negative regulation of cytokine-mediated signaling pathway
GO:0051173	0.421	positive regulation of nitrogen compound metabolic process
GO:0044093	0.378	positive regulation of molecular function
GO:0048522	0.364	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005634	0.999	nucleus
GO:1990234	0.980	transferase complex
GO:0061695	0.971	transferase complex, transferring phosphorus-containing groups
GO:1902911	0.937	protein kinase complex
GO:1902554	0.928	serine/threonine protein kinase complex
GO:0005576	0.345	extracellular region
GO:0008385	0.332	IkappaB kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]