StarFunc result for job id Q8WXD9

User Input

>input (1431 residues)
MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQDPDGFSALHHAALNG
NTELISLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKAGSAVNIPSDEGHIPLH
LAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPR
PGDATDPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTKSGTALHEAALCGKTEVVRLL
LDSGINAHVRNTYSQTALDIVHQFTTSQASREIKQLLREASAALQVRATKDYCNNYDLTS
LNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSSLGEAIVKRAGSRAGTEPSLP
QGSSSSGPSAPPEEIWVLRKPFAGGDRSGSISGMAGGRGSGGHALHAGSEGVKLLATVLS
QKSVSESGPGDSPAKPPEGSAGVARSQPPVAHAGQVYGEQPPKKLEPASEGKSSEAVSQW
LTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPE
HKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVR
KLAELQKAEYAKYEGGPLRRKAPQSLEVMAIESPPPPEPTPADCQSPKMTTFQDSELSDE
LQAAMTGPAEVGPTTEKPSSHLPPTPRATTRQDSSLGGRARHMSSSQELLGDGPPGPSSP
MSRSQEYLLDEGPAPGTPPREARPGRHGHSIKRASVPPVPGKPRQVLPPGTSHFTPPQTP
TKTRPGSPQALGGPHGPAPATAKVKPTPQLLPPTERPMSPRSLPQSPTHRGFAYVLPQPV
EGEVGPAAPGPAPPPVPTAVPTLCLPPEADAEPGRPKKRAHSLNRYAASDSEPERDELLV
PAAAGPYATVQRRVGRSHSVRAPAGADKNVNRSQSFAVRPRKKGPPPPPPKRSSSALASA
NLADEPVPDAEPEDGLLGVRAQCRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAA
RRPPEGHPTPRPASPEPGRVATVLASVKHKEAIGPGGEVVNRRRTLSGPVTGLLATARRG
PGESADPGPFVEDGTGRQRPRGPSKGEAGVEGPPLAKVEASATLKRRIRAKQNQQENVKF
ILTESDTVKRRPKAKEREAGPEPPPPLSVYHNGTGTVRRRPASEQAGPPELPPPPPPAEP
PPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPVPKLQGSPTPTSKKVPLPGPGSPEV
KRAHGTPPPVSPKPPPPPTAPKPVKAVAGLPSGSAGPSPAPSPARQPPAALAKPPGTPPS
LGASPAKPPSPGAPALHVPAKPPRAAAAAAAAAAAPPAPPEGASPGDSARQKLEETSACL
AAALQAVEEKIRQEDAQGPRDSAAEKSTGSILDDIGSMFDDLADQLDAMLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXD9	1.000	1.000	0.000	1431	1.000	1.000	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
2	AFDB:E9QEX9	0.168	0.095	1.051E-15	2607	0.182	0.100	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
3	PDB:8cs9A	0.167	0.297	1.116E-12	796	0.059	0.106	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	AFDB:M9NDA1	0.095	0.109	1.216E-12	1230	0.160	0.186	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
5	AFDB:F1QJ05	0.134	0.128	5.377E-12	1509	0.196	0.186	F1QJ05.pdb.gz
6	AFDB:M9NEB2	0.097	0.105	1.061E-11	1273	0.153	0.172	M9NEB2.pdb.gz	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
7	AFDB:A1Z9K8	0.135	0.106	1.429E-11	1871	0.170	0.130	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
8	AFDB:Q7JQG5	0.097	0.149	1.491E-11	924	0.124	0.192	Q7JQG5.pdb.gz	Q7JQG5_DROME Caskin, isoform B OS=Drosophila melanogaster OX=7227 GN=ckn PE=2 SV=1
9	AFDB:A0A0B4LFD7	0.097	0.163	2.590E-11	845	0.116	0.196	A0A0B4LFD7.pdb.gz	A0A0B4LFD7_DROME Caskin, isoform D OS=Drosophila melanogaster OX=7227 GN=ckn PE=4 SV=1
10	AFDB:D3YZU1	0.139	0.096	3.638E-11	2167	0.205	0.136	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
11	AFDB:F1R0Q7	0.131	0.116	5.806E-11	1631	0.171	0.150	F1R0Q7.pdb.gz
12	PDB:4oauC	0.160	0.320	1.542E-10	692	0.053	0.110	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:2dvwA	0.130	0.629	1.404E-9	229	0.045	0.284	2dvwA.pdb.gz
14	PDB:6v9hC	0.145	0.720	1.595E-9	270	0.041	0.219	6v9hC.pdb.gz
15	PDB:5vkqA	0.152	0.146	7.058E-9	1499	0.048	0.046	5vkqA.pdb.gz
16	PDB:6pqpA	0.139	0.304	3.701E-8	615	0.048	0.112	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
17	PDB:1wg0A	0.128	0.596	1.569E-7	243	0.042	0.247	1wg0A.pdb.gz
18	PDB:6aunA	0.132	0.283	2.300E-7	618	0.045	0.104	6aunA.pdb.gz
19	PDB:6jd6B	0.102	0.578	2.504E-7	192	0.034	0.250	6jd6B.pdb.gz
20	PDB:6mwqA	0.095	0.250	9.346E-7	493	0.040	0.116	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MB71	0.0	2135	1361	0.857	0.902	F1MB71_BOVIN CASK interacting protein 1 OS=Bos taurus OX=9913 GN=CASKIN1 PE=4 SV=3
2	Q8VHK2	0.0	2325	1430	0.901	0.902	CSKI1_RAT Caskin-1 OS=Rattus norvegicus OX=10116 GN=Caskin1 PE=1 SV=1
3	Q8WXD9	0.0	2833	1431	1.000	1.000	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
4	Q8BIZ1	8.80e-55	212	1259	0.084	0.095	ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus OX=10090 GN=Anks1b PE=1 SV=3
5	J3QSU0	1.21e-54	196	332	0.071	0.307	J3QSU0_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1B (Fragment) OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
6	Q7Z6G8	1.77e-54	211	1248	0.080	0.092	ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
7	P0C6S7	2.93e-54	210	1260	0.080	0.090	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
8	Q92625	5.88e-49	193	1134	0.069	0.087	ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4
9	A0A3B3ITU5	6.08e-48	180	455	0.068	0.215	A0A3B3ITU5_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A (Fragment) OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
10	A0A3B3ISP1	3.14e-46	184	1194	0.069	0.083	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
11	P59672	6.02e-46	183	1150	0.070	0.087	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
12	A0A0B4LFD7	2.61e-34	145	845	0.042	0.071	A0A0B4LFD7_DROME Caskin, isoform D OS=Drosophila melanogaster OX=7227 GN=ckn PE=4 SV=1
13	Q7JQG5	4.51e-34	144	924	0.042	0.065	Q7JQG5_DROME Caskin, isoform B OS=Drosophila melanogaster OX=7227 GN=ckn PE=2 SV=1
14	M9MRX4	8.26e-30	132	13559	0.058	0.006	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	X2JCM1	8.34e-30	132	11634	0.058	0.007	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	A8JNM6	1.62e-28	128	4189	0.061	0.021	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	Q7KU92	1.63e-28	127	4083	0.061	0.021	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
18	A8JNM7	1.65e-28	127	4114	0.061	0.021	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	A8JNM5	1.76e-28	127	4264	0.061	0.020	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	X2JC49	1.91e-28	127	4233	0.061	0.021	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.2e-25	100.0	Ankyrin repeat
2	PF12796 Ank_2	3.4e-37	138.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.5e-22	86.3	Ankyrin repeat
4	PF13637 Ank_4	4e-30	115.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.8e-30	115.9	Ankyrin repeats (many copies)
6	PF16907 Caskin-Pro-rich	1.1e-29	114.1	Proline rich region of Caskin proteins
7	PF16632 Caskin-tail	9.9e-26	101.3	C-terminal region of Caskin
8	PF16600 Caskin1-CID	3.2e-16	70.7	Caskin1 CASK-interaction domain
9	PF00536 SAM_1	3e-29	112.6	SAM domain (Sterile alpha motif)
10	PF07647 SAM_2	3.5e-23	92.8	SAM domain (Sterile alpha motif)
11	PF00018 SH3_1	3.4	18.7	SH3 domain
12	PF07653 SH3_2	0.031	25.4	Variant SH3 domain
13	PF14604 SH3_9	21	16.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367408	0.970	Peripheral plasma membrane protein CASK
2	9606.ENSP00000385142	0.859	Neurexin-1
3	9606.ENSP00000367125	0.808	Probable G-protein coupled receptor 153
4	9606.ENSP00000265381	0.758	Amyloid-beta A4 precursor protein-binding family A member 1
5	9606.ENSP00000356579	0.733	Centrosome-associated protein 350
6	9606.ENSP00000253925	0.691	Liprin-alpha-1
7	9606.ENSP00000450337	0.682	Liprin-alpha-2
8	9606.ENSP00000335614	0.656	Liprin-alpha-3
9	9606.ENSP00000247986	0.611	Kinesin-like protein KIF17
10	9606.ENSP00000381412	0.600	Calcium/calmodulin-dependent protein kinase type II subunit alpha
11	9606.ENSP00000374205	0.580	T-box brain protein 1
12	9606.ENSP00000429562	0.574	Protein unc-13 homolog A
13	9606.ENSP00000339850	0.569	Dihydropyrimidinase-related protein 4
14	9606.ENSP00000323516	0.567	Urotensin-2 receptor
15	9606.ENSP00000471502	0.562	Leucine-rich repeat-containing protein 4B
16	9606.ENSP00000265459	0.556	Neurexin-2
17	9606.ENSP00000263373	0.551	Spectrin beta chain, non-erythrocytic 4
18	9606.ENSP00000447488	0.549	Protein lin-7 homolog A
19	9606.ENSP00000340017	0.547	Double C2-like domain-containing protein alpha
20	9606.ENSP00000370812	0.543	Endothelial cell-specific molecule 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0007154	0.989	cell communication
GO:0023052	0.985	signaling
GO:0050896	0.955	response to stimulus
GO:0051716	0.921	cellular response to stimulus
GO:0007165	0.665	signal transduction
GO:0032501	0.391	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0071944	0.932	cell periphery
GO:0016020	0.857	membrane
GO:0043227	0.852	membrane-bounded organelle
GO:0043229	0.777	intracellular organelle
GO:0030054	0.765	cell junction
GO:0043231	0.637	intracellular membrane-bounded organelle
GO:0005886	0.617	plasma membrane
GO:0045202	0.427	synapse
GO:0043233	0.423	organelle lumen
GO:0070013	0.411	intracellular organelle lumen
GO:0031981	0.400	nuclear lumen
GO:0005829	0.383	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]