StarFunc result for job id Q8WXE1

User Input

>input (791 residues)
MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDL
EELDTLASQALSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQ
YKELKEKMKVMEEEVLIKNGEIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKE
FSKKLQSLQSELQFKDAEMNELRTKLQTSERANKLAAPSVSHVSPRKNPSVVIKPEACSP
QFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKPHSLRGDSIKQEEAQKSFVDS
WRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGFGSTLAGMSGL
RTTGSYDGSFSLSALREAQNLAFTGLNLVARNECSRDGDPAEGGRRAFPLCQLPGAVHFL
PLVQFFIGLHCQALQDLAAAKRSGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALS
ILQHLVCHSGAVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLK
MLLHLLAFSSAATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPL
PSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDRVALETQWLQLEQEVV
WLLAKLGVQSPLPPVTGSNCQCNVEVVRALTVMLHRQWLTVRRAGGPPRTDQQRRTVRCL
RDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEEAALDDLCAAE
TDVEDPEVECG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2U4	0.737	0.737	1.076E-89	791	1.000	1.000	A0A024R2U4.pdb.gz
2	AFDB:A0A024R307	0.439	0.453	8.931E-84	764	0.965	0.999	A0A024R307.pdb.gz
3	AFDB:Q8BMG1	0.659	0.663	2.793E-66	785	0.746	0.752	Q8BMG1.pdb.gz	ATRIP_MOUSE ATR-interacting protein OS=Mus musculus OX=10090 GN=Atrip PE=1 SV=2
4	AFDB:P36632	0.298	0.370	6.793E-8	614	0.120	0.155	P36632.pdb.gz	RAD26_SCHPO DNA repair protein rad26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad26 PE=1 SV=2
5	AFDB:C8KI33	0.308	0.365	8.654E-7	646	0.140	0.172	C8KI33.pdb.gz	SUV2_ARATH Protein SENSITIVE TO UV 2 OS=Arabidopsis thaliana OX=3702 GN=SUV2 PE=1 SV=1
6	AFDB:G5EB71	0.242	0.246	3.156E-6	778	0.129	0.131	G5EB71.pdb.gz	G5EB71_EMENI Rad26-like helical repeats domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05165 PE=4 SV=1
7	AFDB:R4GLV5	0.128	0.095	6.636E-4	1116	0.166	0.117	R4GLV5.pdb.gz
8	AFDB:Q55FT4	0.217	0.088	8.595E-4	2247	0.121	0.043	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
9	AFDB:Q1LY17	0.122	0.117	9.783E-4	835	0.120	0.114	Q1LY17.pdb.gz	Q1LY17_DANRE Nucleolar MIF4G domain-containing protein 1 isoform 1 OS=Danio rerio OX=7955 GN=si:ch211-266o5.1 PE=1 SV=2
10	AFDB:Q55FD8	0.193	0.089	1.113E-3	1982	0.119	0.047	Q55FD8.pdb.gz	GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum OX=44689 GN=gefV PE=2 SV=1
11	PDB:7mvvA	0.230	0.135	1.971E-3	1542	0.097	0.050	7mvvA.pdb.gz	Architecture of the linker-scaffold in the nuclear pore.
12	PDB:5yz0C	0.053	0.080	2.783E-3	362	0.402	0.878	5yz0C.pdb.gz
13	PDB:3m62A	0.195	0.169	9.721E-3	955	0.075	0.062	3m62A.pdb.gz
14	PDB:7m6aA	0.197	0.043	1.206E-2	4306	0.048	0.009	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
15	PDB:4hm9A	0.229	0.332	1.631E-2	511	0.056	0.086	4hm9A.pdb.gz
16	PDB:6lthL	0.210	0.317	2.206E-2	466	0.052	0.088	6lthL.pdb.gz	Structure of nucleosome-bound human BAF complex.
17	PDB:4jlqA	0.153	0.146	2.405E-2	840	0.080	0.075	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	PDB:5tbkA	0.200	0.327	2.511E-2	417	0.066	0.125	5tbkA.pdb.gz
19	PDB:6swy5	0.161	0.161	3.115E-2	789	0.070	0.070	6swy5.pdb.gz
20	PDB:7lt3C	0.113	0.038	3.252E-2	3720	0.073	0.016	7lt3C.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BMG1	0.0	1133	785	0.746	0.752	ATRIP_MOUSE ATR-interacting protein OS=Mus musculus OX=10090 GN=Atrip PE=1 SV=2
2	Q8WXE1	0.0	1606	791	1.000	1.000	ATRIP_HUMAN ATR-interacting protein OS=Homo sapiens OX=9606 GN=ATRIP PE=1 SV=1
3	B7ZS92	6.12e-170	512	801	0.427	0.422	B7ZS92_XENLA Atrip protein OS=Xenopus laevis OX=8355 GN=atrip PE=2 SV=1
4	A0A0U1RRM7	1.28e-133	396	196	0.248	1.000	A0A0U1RRM7_HUMAN ATR interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=ATRIP PE=1 SV=1
5	P40414	0.001	42.7	161	0.038	0.186	TPM2_YEAST Tropomyosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPM2 PE=1 SV=1
6	Q9VVN4	0.003	43.5	846	0.034	0.032	ATRIP_DROME ATR-interacting protein mus304 OS=Drosophila melanogaster OX=7227 GN=mus304 PE=1 SV=2
7	Q8MMD2	0.13	38.5	1232	0.040	0.026	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
8	Q8WQ61	0.22	37.7	1253	0.032	0.020	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
9	Q9W111	0.22	37.7	1253	0.032	0.020	Q9W111_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform A OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=2
10	E3CTP7	0.30	37.0	792	0.040	0.040	E3CTP7_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform D OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
11	E7EX90	0.37	37.0	1256	0.039	0.025	E7EX90_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=1
12	Q14203	0.38	37.0	1278	0.039	0.024	DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3
13	Q8MMD3	0.38	37.0	1106	0.043	0.031	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
14	P40574	0.51	35.4	245	0.023	0.073	YAP5_YEAST AP-1-like transcription factor YAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP5 PE=1 SV=1
15	Q8IDX6	0.66	36.2	3130	0.034	0.009	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
16	P28023	0.76	35.8	1280	0.037	0.023	DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2
17	Q00798	0.93	35.8	2833	0.043	0.012	RBP1_PLAVB Reticulocyte-binding protein 1 OS=Plasmodium vivax (strain Belem) OX=31273 GN=RBP1 PE=3 SV=3
18	Q9P246	0.98	35.4	746	0.023	0.024	STIM2_HUMAN Stromal interaction molecule 2 OS=Homo sapiens OX=9606 GN=STIM2 PE=1 SV=2
19	Q7SYB5	1.6	34.7	612	0.037	0.047	DEFI6_DANRE Differentially expressed in FDCP 6 homolog OS=Danio rerio OX=7955 GN=def6 PE=2 SV=1
20	P83093	1.7	34.7	746	0.021	0.023	STIM2_MOUSE Stromal interaction molecule 2 OS=Mus musculus OX=10090 GN=Stim2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16515 HIP1_clath_bdg	7.3e+02	12.0	Clathrin-binding domain of Huntingtin-interacting protein 1
2	PF15905 HMMR_N	2.2e+02	12.7	Hyaluronan mediated motility receptor N-terminal
3	PF12718 Tropomyosin_1	33	16.1	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254719	0.999	Replication protein A 70 kDa DNA-binding subunit
2	9606.ENSP00000260810	0.999	DNA topoisomerase 2-binding protein 1
3	9606.ENSP00000343741	0.999	Serine/threonine-protein kinase ATR
4	9606.ENSP00000278616	0.996	Serine-protein kinase ATM
5	9606.ENSP00000363017	0.993	Replication protein A 32 kDa subunit
6	9606.ENSP00000311360	0.992	Cell cycle checkpoint control protein RAD9A
7	9606.ENSP00000426191	0.992	Cell cycle checkpoint protein RAD17
8	9606.ENSP00000258774	0.989	Checkpoint protein HUS1
9	9606.ENSP00000388648	0.989	Serine/threonine-protein kinase Chk1
10	9606.ENSP00000307288	0.988	DNA replication licensing factor MCM7
11	9606.ENSP00000312995	0.985	Claspin
12	9606.ENSP00000418960	0.982	Breast cancer type 1 susceptibility protein
13	9606.ENSP00000450607	0.971	Protein timeless homolog
14	9606.ENSP00000261881	0.968	TIMELESS-interacting protein
15	9606.ENSP00000055077	0.966	Replication factor C subunit 2
16	9606.ENSP00000287647	0.964	Fanconi anemia group D2 protein
17	9606.ENSP00000310842	0.960	Fanconi anemia group I protein
18	9606.ENSP00000265056	0.957	DNA replication licensing factor MCM2
19	9606.ENSP00000266970	0.956	Cyclin-dependent kinase 2
20	9606.ENSP00000278935	0.956	Centrosomal protein of 164 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070530	0.993	K63-linked polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051716	0.998	cellular response to stimulus
GO:1901987	0.996	regulation of cell cycle phase transition
GO:0048523	0.995	negative regulation of cellular process
GO:0000077	0.987	DNA damage checkpoint signaling
GO:0071704	0.741	organic substance metabolic process
GO:0044237	0.721	cellular metabolic process
GO:0006807	0.714	nitrogen compound metabolic process
GO:0034641	0.656	cellular nitrogen compound metabolic process
GO:0044238	0.652	primary metabolic process
GO:1901360	0.638	organic cyclic compound metabolic process
GO:0006725	0.616	cellular aromatic compound metabolic process
GO:0043170	0.611	macromolecule metabolic process
GO:0006139	0.571	nucleobase-containing compound metabolic process
GO:0090304	0.531	nucleic acid metabolic process
GO:0044260	0.370	cellular macromolecule metabolic process
GO:0006259	0.349	DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0140513	0.969	nuclear protein-containing complex
GO:0043232	0.517	intracellular non-membrane-bounded organelle
GO:0005737	0.446	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]