StarFunc result for job id Q8WXF0

User Input

>input (261 residues)
MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFED
VRDAEDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRT
RSRSSSWGRNRRRSDSLKESRHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNFGSRGRS
RSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKVQT
AKHSHFRSHSRSRSYRHKNSW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXF0	0.999	0.999	3.027E-40	261	1.000	1.000	Q8WXF0.pdb.gz	SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens OX=9606 GN=SRSF12 PE=2 SV=1
2	AFDB:A0A0S2Z504	0.382	0.381	1.320E-20	262	0.556	0.553	A0A0S2Z504.pdb.gz	A0A0S2Z504_HUMAN Serine/arginine-rich splicing factor 10 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF10 PE=2 SV=1
3	AFDB:Q9SEU4	0.365	0.333	4.158E-14	287	0.356	0.324	Q9SEU4.pdb.gz	SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana OX=3702 GN=SCL33 PE=1 SV=1
4	AFDB:Q8L3X8	0.351	0.350	9.268E-14	262	0.291	0.290	Q8L3X8.pdb.gz	SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana OX=3702 GN=SCL30 PE=1 SV=1
5	AFDB:Q8I468	0.354	0.301	4.029E-13	308	0.280	0.237	Q8I468.pdb.gz	Q8I468_PLAF7 Serine/arginine-rich splicing factor 12 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0503300 PE=4 SV=1
6	AFDB:Q09511	0.313	0.412	8.981E-13	196	0.314	0.418	Q09511.pdb.gz	RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans OX=6239 GN=rsp-4 PE=3 SV=1
7	AFDB:A0A024R8U5	0.323	0.380	1.026E-12	221	0.333	0.394	A0A024R8U5.pdb.gz
8	AFDB:Q9V3T8	0.315	0.418	5.100E-12	195	0.284	0.379	Q9V3T8.pdb.gz	Q9V3T8_DROME LD32469p OS=Drosophila melanogaster OX=7227 GN=SC35 PE=1 SV=1
9	AFDB:D6W5Y5	0.291	0.257	6.231E-12	297	0.245	0.215	D6W5Y5.pdb.gz	D6W5Y5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
10	AFDB:Q9FMG4	0.334	0.292	9.946E-12	303	0.333	0.287	Q9FMG4.pdb.gz	SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana OX=3702 GN=SC35 PE=1 SV=1
11	PDB:6qx91K	0.302	0.391	4.109E-9	201	0.092	0.119	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:5yzg1	0.293	0.315	6.134E-9	243	0.107	0.115	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6ff7X	0.283	0.421	1.047E-8	171	0.100	0.152	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:1hl6A	0.291	0.622	1.786E-8	119	0.077	0.168	1hl6A.pdb.gz
15	PDB:5xjcw	0.291	0.798	1.786E-8	91	0.092	0.264	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
16	PDB:5gm6V	0.317	0.626	2.182E-8	128	0.107	0.219	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6gd1A	0.292	0.397	2.494E-8	190	0.073	0.100	6gd1A.pdb.gz
18	PDB:7dvqY	0.310	0.567	3.258E-8	140	0.080	0.150	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:6y53o	0.281	0.453	1.619E-7	160	0.065	0.106	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
20	PDB:5oobB	0.313	0.529	1.731E-7	152	0.077	0.132	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXF0	0.0	518	261	1.000	1.000	SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens OX=9606 GN=SRSF12 PE=2 SV=1
2	A0A0S2Z504	3.25e-65	206	262	0.345	0.344	A0A0S2Z504_HUMAN Serine/arginine-rich splicing factor 10 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF10 PE=2 SV=1
3	A0A8J8XB26	3.25e-65	206	262	0.345	0.344	A0A8J8XB26_RAT Serine and arginine rich splicing factor 10 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
4	O75494	3.25e-65	206	262	0.345	0.344	SRS10_HUMAN Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10 PE=1 SV=1
5	Q9R0U0	3.25e-65	206	262	0.345	0.344	SRS10_MOUSE Serine/arginine-rich splicing factor 10 OS=Mus musculus OX=10090 GN=Srsf10 PE=1 SV=2
6	A0A8I6A795	3.59e-65	205	261	0.345	0.345	A0A8I6A795_RAT Serine and arginine rich splicing factor 10 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
7	Q4KM38	7.62e-65	201	164	0.345	0.549	Q4KM38_RAT FUS interacting protein (Serine-arginine rich) 1 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
8	A0A8I6AMK7	9.03e-65	202	183	0.345	0.492	A0A8I6AMK7_RAT Serine and arginine rich splicing factor 10 OS=Rattus norvegicus OX=10116 GN=Srsf10 PE=1 SV=1
9	Q9LHP2	1.70e-23	97.8	262	0.149	0.149	SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana OX=3702 GN=SCL30A PE=1 SV=1
10	Q9SEU4	4.36e-22	94.7	287	0.149	0.136	SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana OX=3702 GN=SCL33 PE=1 SV=1
11	Q1PDV2	8.04e-22	92.8	236	0.149	0.165	SRC28_ARATH Serine/arginine-rich SC35-like splicing factor SCL28 OS=Arabidopsis thaliana OX=3702 GN=SCL28 PE=1 SV=1
12	Q8I468	2.02e-21	93.2	308	0.207	0.175	Q8I468_PLAF7 Serine/arginine-rich splicing factor 12 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0503300 PE=4 SV=1
13	Q8L3X8	6.20e-21	90.9	262	0.180	0.179	SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana OX=3702 GN=SCL30 PE=1 SV=1
14	Q9V3T8	6.84e-18	81.3	195	0.161	0.215	Q9V3T8_DROME LD32469p OS=Drosophila melanogaster OX=7227 GN=SC35 PE=1 SV=1
15	J3QL05	9.29e-17	76.6	130	0.157	0.315	J3QL05_HUMAN Serine and arginine rich splicing factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=1
16	J3KP15	1.00e-16	76.6	133	0.157	0.308	J3KP15_HUMAN Serine and arginine rich splicing factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=8
17	Q01130	6.90e-16	76.3	221	0.157	0.186	SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4
18	Q62093	6.90e-16	76.3	221	0.157	0.186	SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus OX=10090 GN=Srsf2 PE=1 SV=4
19	Q6PDU1	6.90e-16	76.3	221	0.157	0.186	SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus OX=10116 GN=Srsf2 PE=1 SV=3
20	Q09511	2.65e-15	74.3	196	0.153	0.204	RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans OX=6239 GN=rsp-4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	3.3	19.1	Nup53/35/40-type RNA recognition motif
2	PF00076 RRM_1	5.2e-16	69.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414302

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307863	0.748	Splicing factor U2AF 65 kDa subunit
2	9606.ENSP00000258962	0.696	Serine/arginine-rich splicing factor 1
3	9606.ENSP00000229390	0.688	Serine/arginine-rich splicing factor 9
4	9606.ENSP00000359988	0.681	Serine/arginine-rich splicing factor 11
5	9606.ENSP00000357345	0.675	Dual specificity protein kinase CLK2
6	9606.ENSP00000297071	0.668	Transformer-2 protein homolog alpha
7	9606.ENSP00000254108	0.667	RNA-binding protein FUS
8	9606.ENSP00000378505	0.611	Dual specificity protein kinase CLK3
9	9606.ENSP00000337513	0.596	Steroid receptor RNA activator 1
10	9606.ENSP00000472998	0.589	U1 small nuclear ribonucleoprotein 70 kDa
11	9606.ENSP00000347005	0.588	Putative RNA-binding protein Luc7-like 2
12	9606.ENSP00000261973	0.542	RNA-binding protein 25
13	9606.ENSP00000296215	0.530	Smad nuclear-interacting protein 1
14	9606.ENSP00000305596	0.517	Protein FAM71B
15	9606.ENSP00000238146	0.515	ATP-dependent RNA helicase DDX55
16	9606.ENSP00000382972	0.512	Small nuclear ribonucleoprotein-associated protein N
17	9606.ENSP00000348984	0.508	Protein SON
18	9606.ENSP00000397566	0.505	General transcription factor II-I repeat domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.986	protein binding
GO:0003729	0.589	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006397	0.996	mRNA processing
GO:0050789	0.995	regulation of biological process
GO:0000398	0.992	mRNA splicing, via spliceosome
GO:0051252	0.989	regulation of RNA metabolic process
GO:0010468	0.988	regulation of gene expression
GO:0043484	0.975	regulation of RNA splicing
GO:0000245	0.965	spliceosomal complex assembly
GO:1903311	0.945	regulation of mRNA metabolic process
GO:0050684	0.939	regulation of mRNA processing
GO:0048024	0.930	regulation of mRNA splicing, via spliceosome
GO:0006376	0.753	mRNA splice site selection
GO:0045292	0.577	mRNA cis splicing, via spliceosome
GO:0000381	0.310	regulation of alternative mRNA splicing, via spliceosome
GO:0048519	0.305	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016604	0.883	nuclear body
GO:0016607	0.788	nuclear speck
GO:0032991	0.664	protein-containing complex
GO:1990904	0.451	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]