StarFunc result for job id Q8WXF1

User Input

>input (523 residues)
MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEE
MGFTIDIKSFLKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFG
FIRLESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFG
PVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDD
EDGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREA
KEKLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQLRHEEEHRRRE
EEMIRHREQEELRRQQEGFKPNYMENREQEMRMGDMGPRGAINMGDAFSPAPAGNQGPPP
MMGMNMNNRATIPGPPMGPGPAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMG
SRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R326	0.783	0.783	5.995E-80	523	0.977	0.977	Q8R326.pdb.gz	PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus OX=10090 GN=Pspc1 PE=1 SV=1
2	AFDB:Q5FVM4	0.618	0.678	4.622E-49	476	0.553	0.607	Q5FVM4.pdb.gz	NONO_RAT Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus OX=10116 GN=Nono PE=1 SV=3
3	AFDB:Q802Z5	0.611	0.723	6.245E-49	441	0.503	0.596	Q802Z5.pdb.gz	Q802Z5_DANRE Non-POU domain-containing octamer-binding protein OS=Danio rerio OX=7955 GN=wu:fb40d10 PE=1 SV=1
4	AFDB:A0A384N5Z8	0.573	0.427	7.272E-47	707	0.568	0.420	A0A384N5Z8.pdb.gz	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:Q1L8R2	0.581	0.477	4.704E-46	638	0.512	0.420	Q1L8R2.pdb.gz
6	AFDB:B3GWA1	0.498	0.464	9.347E-35	562	0.354	0.329	B3GWA1.pdb.gz	B3GWA1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
7	AFDB:Q9U1N0	0.529	0.518	2.450E-34	535	0.323	0.316	Q9U1N0.pdb.gz	HRP65_CHITE Hrp65 protein OS=Chironomus tentans OX=7153 GN=HRP65 PE=1 SV=1
8	AFDB:Q04047	0.533	0.404	4.287E-31	700	0.306	0.229	Q04047.pdb.gz	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
9	AFDB:Q19579	0.156	0.123	1.123E-13	692	0.210	0.159	Q19579.pdb.gz	Q19579_CAEEL Polyadenylate-binding protein OS=Caenorhabditis elegans OX=6239 GN=pab-2 PE=1 SV=1
10	AFDB:Q9HCJ3	0.277	0.212	5.706E-13	691	0.168	0.127	Q9HCJ3.pdb.gz	RAVR2_HUMAN Ribonucleoprotein PTB-binding 2 OS=Homo sapiens OX=9606 GN=RAVER2 PE=1 SV=2
11	PDB:6y53o	0.141	0.438	3.179E-10	160	0.082	0.269	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:5vsuA	0.151	0.198	5.806E-10	387	0.069	0.093	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:7oqcF	0.137	0.261	2.056E-9	267	0.076	0.150	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	PDB:6y5qq	0.130	0.360	3.702E-8	178	0.065	0.191	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:6r5kH	0.152	0.196	5.643E-8	394	0.098	0.129	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
16	PDB:6ff7X	0.132	0.383	1.882E-7	171	0.061	0.187	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5lsbA	0.167	0.416	2.701E-7	176	0.057	0.170	5lsbA.pdb.gz
18	PDB:7evoD	0.136	0.344	4.644E-7	200	0.071	0.185	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
19	PDB:3lqvB	0.140	0.592	1.722E-5	115	0.042	0.191	3lqvB.pdb.gz	Branch Recognition by SF3b14
20	PDB:6n7pA	0.139	0.374	2.625E-5	186	0.036	0.102	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R326	0.0	1024	523	0.977	0.977	PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus OX=10090 GN=Pspc1 PE=1 SV=1
2	Q8WXF1	0.0	1054	523	1.000	1.000	PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1
3	A0A0S2Z4Z9	2.21e-166	481	471	0.535	0.594	A0A0S2Z4Z9_HUMAN Non-POU domain containing octamer-binding isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=2 SV=1
4	Q15233	2.21e-166	481	471	0.535	0.594	NONO_HUMAN Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4
5	Q99K48	8.42e-165	477	473	0.541	0.598	NONO_MOUSE Non-POU domain-containing octamer-binding protein OS=Mus musculus OX=10090 GN=Nono PE=1 SV=3
6	Q5FVM4	1.09e-162	472	476	0.533	0.586	NONO_RAT Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus OX=10116 GN=Nono PE=1 SV=3
7	A0A384N5Z8	2.89e-161	476	707	0.528	0.390	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	P23246	2.89e-161	476	707	0.528	0.390	SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2
9	Q4KM71	5.45e-161	476	699	0.526	0.393	Q4KM71_RAT Splicing factor proline and glutamine rich OS=Rattus norvegicus OX=10116 GN=Sfpq PE=1 SV=1
10	Q8VIJ6	8.77e-161	475	699	0.526	0.393	SFPQ_MOUSE Splicing factor, proline- and glutamine-rich OS=Mus musculus OX=10090 GN=Sfpq PE=1 SV=1
11	Q802Z5	3.13e-160	464	441	0.455	0.540	Q802Z5_DANRE Non-POU domain-containing octamer-binding protein OS=Danio rerio OX=7955 GN=wu:fb40d10 PE=1 SV=1
12	Q6NUU2	1.93e-154	456	619	0.451	0.381	Q6NUU2_DANRE Splicing factor proline/glutamine rich (Polypyrimidine tract binding protein associated) OS=Danio rerio OX=7955 GN=zgc:85935 PE=1 SV=1
13	Q9U1N0	4.47e-81	264	535	0.260	0.254	HRP65_CHITE Hrp65 protein OS=Chironomus tentans OX=7153 GN=HRP65 PE=1 SV=1
14	B3GWA1	5.28e-80	262	562	0.241	0.224	B3GWA1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
15	Q04047	8.24e-79	262	700	0.268	0.200	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
16	Q8I7K5	3.74e-74	241	374	0.220	0.307	Q8I7K5_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
17	C9IZL7	1.32e-70	226	207	0.208	0.527	C9IZL7_HUMAN Non-POU domain-containing octamer-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=1
18	C9J4X2	1.22e-22	95.5	124	0.096	0.403	C9J4X2_HUMAN Non-POU domain-containing octamer-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=1
19	B3GWA0	4.08e-16	80.9	282	0.075	0.138	B3GWA0_CAEEL NOPS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
20	P31209	3.07e-14	77.8	653	0.088	0.070	PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08075 NOPS	8.1e-25	98.0	NOPS (NUC059) domain
2	PF00076 RRM_1	5e-29	111.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	1.7	20.1	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343966

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276079	0.977	Non-POU domain-containing octamer-binding protein
2	9606.ENSP00000349748	0.948	Splicing factor, proline- and glutamine-rich
3	9606.ENSP00000311747	0.881	RNA-binding protein 14
4	9606.ENSP00000300291	0.728	Cleavage and polyadenylation specificity factor subunit 5
5	9606.ENSP00000012443	0.688	Serine/threonine-protein phosphatase 5
6	9606.ENSP00000276692	0.681	Putative deoxyribonuclease TATDN1
7	9606.ENSP00000258962	0.669	Serine/arginine-rich splicing factor 1
8	9606.ENSP00000472308	0.662	Testis-expressed protein 101
9	9606.ENSP00000388552	0.639	RNA-binding protein 14
10	9606.ENSP00000322915	0.617	Zinc finger MYM-type protein 4
11	9606.ENSP00000365950	0.606	RNA-binding protein 3
12	9606.ENSP00000254108	0.602	RNA-binding protein FUS
13	9606.ENSP00000372088	0.598	DNA repair protein RAD51 homolog 1
14	9606.ENSP00000342374	0.594	Small nuclear ribonucleoprotein Sm D2
15	9606.ENSP00000296702	0.591	Transcription elongation regulator 1
16	9606.ENSP00000354346	0.590	Matrin-3
17	9606.ENSP00000322845	0.576	Zinc finger MYM-type protein 3
18	9606.ENSP00000307863	0.574	Splicing factor U2AF 65 kDa subunit
19	9606.ENSP00000246548	0.568	SUMO-activating enzyme subunit 2
20	9606.ENSP00000266679	0.561	Cleavage and polyadenylation specificity factor subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	0.515	DNA binding
GO:0042802	0.479	identical protein binding
GO:0003729	0.323	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.986	regulation of cellular process
GO:0048518	0.971	positive regulation of biological process
GO:0048519	0.958	negative regulation of biological process
GO:0019222	0.952	regulation of metabolic process
GO:0051171	0.936	regulation of nitrogen compound metabolic process
GO:0060255	0.926	regulation of macromolecule metabolic process
GO:0031323	0.899	regulation of cellular metabolic process
GO:0048523	0.859	negative regulation of cellular process
GO:0080090	0.837	regulation of primary metabolic process
GO:0048583	0.832	regulation of response to stimulus
GO:0009987	0.825	cellular process
GO:0002833	0.819	positive regulation of response to biotic stimulus
GO:0010468	0.808	regulation of gene expression
GO:0032101	0.791	regulation of response to external stimulus
GO:0008152	0.769	metabolic process
GO:0019219	0.761	regulation of nucleobase-containing compound metabolic process
GO:0080134	0.741	regulation of response to stress
GO:0006807	0.736	nitrogen compound metabolic process
GO:0071704	0.733	organic substance metabolic process
GO:0051252	0.720	regulation of RNA metabolic process
GO:0044238	0.716	primary metabolic process
GO:0002682	0.709	regulation of immune system process
GO:0031326	0.703	regulation of cellular biosynthetic process
GO:0010556	0.699	regulation of macromolecule biosynthetic process
GO:0031347	0.696	regulation of defense response
GO:0043170	0.684	macromolecule metabolic process
GO:0050776	0.682	regulation of immune response
GO:0002684	0.676	positive regulation of immune system process
GO:0045088	0.628	regulation of innate immune response
GO:0045089	0.616	positive regulation of innate immune response
GO:0010605	0.606	negative regulation of macromolecule metabolic process
GO:2001141	0.602	regulation of RNA biosynthetic process
GO:0002253	0.556	activation of immune response
GO:0045934	0.552	negative regulation of nucleobase-containing compound metabolic process
GO:1903506	0.533	regulation of nucleic acid-templated transcription
GO:0051253	0.533	negative regulation of RNA metabolic process
GO:0044237	0.523	cellular metabolic process
GO:0006355	0.512	regulation of DNA-templated transcription
GO:0034641	0.457	cellular nitrogen compound metabolic process
GO:1901360	0.420	organic cyclic compound metabolic process
GO:0006725	0.420	cellular aromatic compound metabolic process
GO:0046483	0.417	heterocycle metabolic process
GO:0006139	0.412	nucleobase-containing compound metabolic process
GO:0048522	0.408	positive regulation of cellular process
GO:0010558	0.392	negative regulation of macromolecule biosynthetic process
GO:0031327	0.391	negative regulation of cellular biosynthetic process
GO:0090304	0.371	nucleic acid metabolic process
GO:0050896	0.349	response to stimulus
GO:0010467	0.306	gene expression
GO:0002218	0.303	activation of innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0016604	0.899	nuclear body
GO:0032991	0.875	protein-containing complex
GO:0005730	0.319	nucleolus
GO:0005737	0.300	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]