StarFunc result for job id Q8WXG1

User Input

>input (361 residues)
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETK
EEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKI
NFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISC
DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKAL
NPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS
YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLD
W

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXG1	1.000	1.000	1.732E-74	361	1.000	1.000	Q8WXG1.pdb.gz	RSAD2_HUMAN S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Homo sapiens OX=9606 GN=RSAD2 PE=1 SV=1
2	AFDB:Q8CBB9	0.820	0.818	4.977E-64	362	0.828	0.826	Q8CBB9.pdb.gz	RSAD2_MOUSE S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Mus musculus OX=10090 GN=Rsad2 PE=1 SV=1
3	AFDB:Q5RH95	0.819	0.824	1.140E-58	359	0.695	0.699	Q5RH95.pdb.gz	RSAD2_DANRE S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Danio rerio OX=7955 GN=rsad2 PE=2 SV=1
4	AFDB:C9J674	0.679	0.836	6.747E-48	293	0.681	0.840	C9J674.pdb.gz	C9J674_HUMAN Radical S-adenosyl methionine domain containing 2 OS=Homo sapiens OX=9606 GN=RSAD2 PE=1 SV=2
5	AFDB:Q8IQF1	0.523	0.352	9.051E-11	565	0.186	0.119	Q8IQF1.pdb.gz	MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster OX=7227 GN=Mocs1 PE=2 SV=1
6	AFDB:Q72EJ8	0.465	0.489	2.675E-10	341	0.122	0.129	Q72EJ8.pdb.gz	Q72EJ8_DESVH GTP 3',8-cyclase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=moaA PE=1 SV=1
7	AFDB:G5EAS9	0.475	0.268	7.444E-10	694	0.155	0.081	G5EAS9.pdb.gz	G5EAS9_EMENI Radical SAM core domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00947 PE=3 SV=1
8	AFDB:P9WJS3	0.460	0.462	3.782E-9	359	0.111	0.111	P9WJS3.pdb.gz	MOAA1_MYCTU GTP 3',8-cyclase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaA1 PE=2 SV=1
9	AFDB:P30745	0.504	0.546	1.704E-8	329	0.119	0.131	P30745.pdb.gz	MOAA_ECOLI GTP 3',8-cyclase OS=Escherichia coli (strain K12) OX=83333 GN=moaA PE=1 SV=1
10	AFDB:Q39055	0.524	0.489	2.168E-8	390	0.163	0.151	Q39055.pdb.gz	CNX2_ARATH GTP 3',8-cyclase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CNX2 PE=1 SV=1
11	PDB:3c8fA	0.465	0.661	4.739E-8	245	0.091	0.135	3c8fA.pdb.gz	Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
12	PDB:3t7vA	0.441	0.469	6.029E-8	337	0.116	0.125	3t7vA.pdb.gz	Crystal structure of methylornithine synthase (PylB): insights into the pyrrolysine biosynthesis.
13	PDB:1r30B	0.480	0.543	9.616E-7	313	0.116	0.134	1r30B.pdb.gz	Crystal structure of biotin synthase, an S-adenosylmethionine-dependent radical enzyme.
14	PDB:1oltA	0.346	0.294	2.103E-6	434	0.094	0.078	1oltA.pdb.gz	Crystal Structure of Coproporphyrinogen III Oxidase Reveals Cofactor Geometry of Radical Sam Enzymes
15	PDB:5th5A	0.382	0.541	7.447E-6	241	0.097	0.145	5th5A.pdb.gz	7-Carboxy-7-deazaguanine Synthase: A Radical S-Adenosyl-l-methionine Enzyme with Polar Tendencies.
16	PDB:6qk7C	0.424	0.358	2.800E-5	444	0.111	0.090	6qk7C.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
17	PDB:5hr7A	0.456	0.458	2.169E-4	360	0.108	0.108	5hr7A.pdb.gz	Crystallographic capture of a radical S-adenosylmethionine enzyme in the act of modifying tRNA.
18	PDB:7qbuA	0.419	0.370	2.169E-4	418	0.089	0.077	7qbuA.pdb.gz	Crystallographic snapshots of a B 12 -dependent radical SAM methyltransferase.
19	PDB:2ftpA	0.388	0.451	2.598E-4	300	0.091	0.110	2ftpA.pdb.gz
20	PDB:1wq5B	0.335	0.436	2.930E-4	261	0.091	0.126	1wq5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70600	0.0	606	360	0.834	0.836	RSAD2_RAT S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Rattus norvegicus OX=10116 GN=Rsad2 PE=1 SV=1
2	Q5RH95	0.0	522	359	0.681	0.685	RSAD2_DANRE S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Danio rerio OX=7955 GN=rsad2 PE=2 SV=1
3	Q8CBB9	0.0	612	362	0.842	0.840	RSAD2_MOUSE S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Mus musculus OX=10090 GN=Rsad2 PE=1 SV=1
4	Q8WXG1	0.0	740	361	1.000	1.000	RSAD2_HUMAN S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 OS=Homo sapiens OX=9606 GN=RSAD2 PE=1 SV=1
5	C9J674	4.49e-179	500	293	0.681	0.840	C9J674_HUMAN Radical S-adenosyl methionine domain containing 2 OS=Homo sapiens OX=9606 GN=RSAD2 PE=1 SV=2
6	G3XD10	3.07e-06	50.8	387	0.130	0.121	G3XD10_PSEAE Heme d1 biosynthesis protein NirJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nirJ PE=4 SV=1
7	P95416	3.07e-06	50.8	387	0.130	0.121	P95416_PSEAI Heme d1 biosynthesis radical SAM protein NirJ OS=Pseudomonas aeruginosa OX=287 GN=nirJ PE=4 SV=1
8	Q72EJ8	4.64e-05	47.4	341	0.091	0.097	Q72EJ8_DESVH GTP 3',8-cyclase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=moaA PE=1 SV=1
9	Q8TUB9	1.43e-04	45.8	350	0.091	0.094	PYLB_METAC 3-methylornithine synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=pylB PE=1 SV=1
10	P9WJS1	3.26e-04	44.7	360	0.105	0.106	MOAA2_MYCTU GTP 3',8-cyclase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaA2 PE=1 SV=1
11	Q46E78	5.21e-04	43.9	350	0.094	0.097	PYLB_METBF 3-methylornithine synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) OX=269797 GN=pylB PE=1 SV=1
12	Q8IQF1	0.028	38.9	565	0.083	0.053	MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster OX=7227 GN=Mocs1 PE=2 SV=1
13	Q9NZB8	0.092	37.4	636	0.105	0.060	MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens OX=9606 GN=MOCS1 PE=1 SV=3
14	P9WJS3	0.12	36.6	359	0.069	0.070	MOAA1_MYCTU GTP 3',8-cyclase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaA1 PE=2 SV=1
15	Q5RKZ7	0.33	35.4	636	0.108	0.061	MOCS1_MOUSE Molybdenum cofactor biosynthesis protein 1 OS=Mus musculus OX=10090 GN=Mocs1 PE=1 SV=2
16	Q39055	0.42	35.0	390	0.083	0.077	CNX2_ARATH GTP 3',8-cyclase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CNX2 PE=1 SV=1
17	P76134	0.83	33.9	385	0.102	0.096	YDEM_ECOLI Anaerobic sulfatase-maturating enzyme homolog YdeM OS=Escherichia coli (strain K12) OX=83333 GN=ydeM PE=3 SV=2
18	P30745	1.2	33.5	329	0.089	0.097	MOAA_ECOLI GTP 3',8-cyclase OS=Escherichia coli (strain K12) OX=83333 GN=moaA PE=1 SV=1
19	P9WJU5	2.0	33.1	1089	0.042	0.014	MMPL8_MYCTU Sulfolipid-1 exporter MmpL8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mmpL8 PE=1 SV=1
20	Q0D9S3	3.2	32.3	530	0.064	0.043	HKT21_ORYSJ Cation transporter HKT2;1 OS=Oryza sativa subsp. japonica OX=39947 GN=HKT2;1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13353 Fer4_12	0.067	25.1	4Fe-4S single cluster domain
2	PF13394 Fer4_14	0.0096	27.4	4Fe-4S single cluster domain
3	PF04055 Radical_SAM	1.1e-12	60.1	Radical SAM superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360869	0.998	Interferon-induced protein with tetratricopeptide repeats 1
2	9606.ENSP00000368699	0.997	Ubiquitin-like protein ISG15
3	9606.ENSP00000381601	0.997	Interferon-induced GTP-binding protein Mx1
4	9606.ENSP00000360883	0.996	Interferon-induced protein with tetratricopeptide repeats 3
5	9606.ENSP00000380697	0.996	Interferon regulatory factor 7
6	9606.ENSP00000342278	0.995	2'-5'-oligoadenylate synthase 2
7	9606.ENSP00000360891	0.995	Interferon-induced protein with tetratricopeptide repeats 2
8	9606.ENSP00000228928	0.994	2'-5'-oligoadenylate synthase 3
9	9606.ENSP00000257570	0.993	2'-5'-oligoadenylate synthase-like protein
10	9606.ENSP00000333657	0.993	Interferon-induced GTP-binding protein Mx2
11	9606.ENSP00000388001	0.993	2'-5'-oligoadenylate synthase 1
12	9606.ENSP00000360860	0.992	Interferon-induced protein with tetratricopeptide repeats 5
13	9606.ENSP00000342513	0.989	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
14	9606.ENSP00000354394	0.989	Signal transducer and activator of transcription 1-alpha/beta
15	9606.ENSP00000354822	0.989	XIAP-associated factor 1
16	9606.ENSP00000349078	0.985	Farnesyl pyrophosphate synthase
17	9606.ENSP00000483430	0.984	Interferon alpha-inducible protein 27, mitochondrial
18	9606.ENSP00000345656	0.978	Vesicle-associated membrane protein-associated protein A
19	9606.ENSP00000395590	0.977	Interferon-induced 35 kDa protein
20	9606.ENSP00000252593	0.976	Bone marrow stromal antigen 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051539	0.993	4 iron, 4 sulfur cluster binding
GO:0043621	0.983	protein self-association
GO:0003824	0.526	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.993	regulation of biological process
GO:0098542	0.985	defense response to other organism
GO:0050794	0.979	regulation of cellular process
GO:0140546	0.977	defense response to symbiont
GO:0009615	0.971	response to virus
GO:0048519	0.915	negative regulation of biological process
GO:0051607	0.866	defense response to virus
GO:0050792	0.721	regulation of viral process
GO:1903900	0.709	regulation of viral life cycle
GO:0048525	0.653	negative regulation of viral process
GO:0009987	0.588	cellular process
GO:0048518	0.494	positive regulation of biological process
GO:0045069	0.482	regulation of viral genome replication
GO:0048523	0.454	negative regulation of cellular process
GO:0019222	0.432	regulation of metabolic process
GO:0045071	0.428	negative regulation of viral genome replication
GO:0051239	0.410	regulation of multicellular organismal process
GO:0060255	0.392	regulation of macromolecule metabolic process
GO:0048522	0.381	positive regulation of cellular process
GO:0002376	0.355	immune system process
GO:0048583	0.332	regulation of response to stimulus
GO:0010468	0.331	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005783	1.000	endoplasmic reticulum
GO:0031981	0.996	nuclear lumen
GO:0016020	0.960	membrane
GO:0031090	0.871	organelle membrane
GO:0005739	0.853	mitochondrion
GO:0005730	0.636	nucleolus
GO:0005829	0.584	cytosol
GO:0031984	0.536	organelle subcompartment
GO:0098588	0.514	bounding membrane of organelle
GO:0031975	0.508	envelope
GO:0031967	0.504	organelle envelope
GO:0005789	0.492	endoplasmic reticulum membrane
GO:0005740	0.346	mitochondrial envelope
GO:0031966	0.338	mitochondrial membrane
GO:0005654	0.323	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]