StarFunc result for job id Q8WXG6

User Input

>input (1647 residues)
MVQKKKFCPRLLDYLVIVGARHPSSDSVAQTPELLRRYPLEDHTEFPLPPDVVFFCQPEG
CLSVRQRRMSLRDDTSFVFTLTDKDTGVTRYGICVNFYRSFQKRISKEKGEGGAGSRGKE
GTHATCASEEGGTESSESGSSLQPLSADSTPDVNQSPRGKRRAKAGSRSRNSTLTSLCVL
SHYPFFSTFRECLYTLKRLVDCCSERLLGKKLGIPRGVQRDTMWRIFTGSLLVEEKSSAL
LHDLREIEAWIYRLLRSPVPVSGQKRVDIEVLPQELQPALTFALPDPSRFTLVDFPLHLP
LELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTCM
ASAEQLLLAPTPYIIGVPASFFLYKLDFKMPDDVWLVDLDSNRVIAPTNAEVLPILPEPE
SLELKKHLKQALASMSLNTQPILNLEKFHEGQEIPLLLGRPSNDLQSTPSTEFNPLIYGN
DVDSVDVATRVAMVRFFNSANVLQGFQMHTRTLRLFPRPVVAFQAGSFLASRPRQTPFAE
KLARTQAVEYFGEWILNPTNYAFQRIHNNMFDPALIGDKPKWYAHQLQPIHYRVYDSNSQ
LAEALSVPPERDSDSEPTDDSGSDSMDYDDSSSSYSSLGDFVSEMMKCDINGDTPNVDPL
THAALGDASEVEIDELQNQKEAEEPGPDSENSQENPPLRSSSSTTASSSPSTVIHGANSE
PADSTEMDDKAAVGVSKPLPSVPPSIGKSNVDRRQAEIGEGSVRRRIYDNPYFEPQYGFP
PEEDEDEQGESYTPRFSQHVSGNRAQKLLRPNSLRLASDSDAESDSRASSPNSTVSNTST
EGFGGIMSFASSLYRNHSTSFSLSNLTLPTKGAREKATPFPSLKVFGLNTLMEIVTEAGP
GSGEGNRRALVDQKSSVIKHSPTVKREPPSPQGRSSNSSENQQFLKEVVHSVLDGQGVGW
LNMKKVRRLLESEQLRVFVLSKLNRMVQSEDDARQDIIPDVEISRKVYKGMLDLLKCTVL
SLEQSYAHAGLGGMASIFGLLEIAQTHYYSKEPDKRKRSPTESVNTPVGKDPGLAGRGDP
KAMAQLRVPQLGPRAPSATGKGPKELDTRSLKEENFIASIELWNKHQEVKKQKALEKQRP
EVIKPVFDLGETEEKKSQISADSGVSLTSSSQRTDQDSVIGVSPAVMIRSSSQDSEVSTV
VSNSSGETLGADSDLSSNAGDGPGGEGSVHLASSRGTLSDSEIETNSATSTIFGKAHSLK
PSIKEKLAGSPIRTSEDVSQRVYLYEGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQ
MQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLIS
YMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKK
QTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRR
NGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQ
VTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYS
VLCLFSYVAAVHSSEEDLRTPPRPVSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08873	0.698	0.717	0.000	1602	0.930	0.956	O08873.pdb.gz	MADD_RAT MAP kinase-activating death domain protein OS=Rattus norvegicus OX=10116 GN=Madd PE=1 SV=1
2	AFDB:Q8WXG6	1.000	1.000	0.000	1647	1.000	1.000	Q8WXG6.pdb.gz	MADD_HUMAN MAP kinase-activating death domain protein OS=Homo sapiens OX=9606 GN=MADD PE=1 SV=2
3	AFDB:Q8TEH3	0.191	0.300	4.783E-11	1009	0.114	0.186	Q8TEH3.pdb.gz	DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2
4	AFDB:Q8K382	0.203	0.317	1.526E-9	1016	0.120	0.195	Q8K382.pdb.gz	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
5	PDB:6xtbE	0.052	0.309	8.070E-5	235	0.019	0.136	6xtbE.pdb.gz
6	PDB:3ljuX	0.068	0.222	1.357E-4	373	0.026	0.113	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	PDB:7nkyO	0.051	0.150	4.180E-4	427	0.013	0.052	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
8	PDB:7nkyQ	0.061	0.180	4.557E-4	404	0.019	0.077	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
9	PDB:6upkH	0.057	0.172	4.970E-4	411	0.018	0.073	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
10	AFDB:Q6ZNL6	0.065	0.071	7.898E-4	1462	0.095	0.107	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
11	PDB:7c3mA	0.047	0.122	3.968E-3	577	0.015	0.043	7c3mA.pdb.gz
12	PDB:7rx9A	0.062	0.188	5.144E-3	432	0.022	0.086	7rx9A.pdb.gz
13	PDB:6hhgA	0.055	0.190	8.647E-3	386	0.008	0.034	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
14	PDB:4rm8A	0.071	0.253	9.030E-3	368	0.017	0.076	4rm8A.pdb.gz
15	AFDB:Q12774	0.062	0.064	9.309E-3	1597	0.090	0.093	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
16	PDB:4mt6A	0.057	0.192	1.277E-2	389	0.019	0.080	4mt6A.pdb.gz
17	AFDB:F4J6F6	0.039	0.044	5.732E-2	1296	0.090	0.115	F4J6F6.pdb.gz	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
18	AFDB:Q9VZ85	0.055	0.049	7.432E-2	1984	0.093	0.077	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
19	AFDB:Q9NP73	0.046	0.056	8.104E-2	1137	0.084	0.122	Q9NP73.pdb.gz	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
20	AFDB:Q54YZ6	0.067	0.088	1.006E-1	1218	0.070	0.094	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRB5	0.0	3236	1588	0.960	0.996	A0A0A0MRB5_HUMAN MAP kinase-activating death domain protein OS=Homo sapiens OX=9606 GN=MADD PE=1 SV=1
2	O08873	0.0	3054	1602	0.930	0.956	MADD_RAT MAP kinase-activating death domain protein OS=Rattus norvegicus OX=10116 GN=Madd PE=1 SV=1
3	Q80U28	0.0	2999	1577	0.913	0.954	MADD_MOUSE MAP kinase-activating death domain protein OS=Mus musculus OX=10090 GN=Madd PE=1 SV=2
4	Q8WXG6	0.0	3403	1647	1.000	1.000	MADD_HUMAN MAP kinase-activating death domain protein OS=Homo sapiens OX=9606 GN=MADD PE=1 SV=2
5	Q9VXY2	5.33e-157	530	2084	0.176	0.139	MADD_DROME MAP kinase-activating death domain protein OS=Drosophila melanogaster OX=7227 GN=Rab3-GEF PE=2 SV=2
6	O02626	3.97e-152	505	1409	0.168	0.197	MADD_CAEEL MAP kinase-activating death domain protein OS=Caenorhabditis elegans OX=6239 GN=aex-3 PE=1 SV=1
7	Q7KSP6	6.21e-21	103	1973	0.083	0.069	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
8	Q9VGH9	7.57e-21	102	1993	0.083	0.068	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
9	Q9W3D3	1.68e-19	98.6	1671	0.062	0.061	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
10	Q5VZ89	4.31e-19	97.1	1909	0.083	0.071	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
11	Q7Z401	3.08e-18	94.4	1863	0.080	0.070	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
12	Q6ZPE2	5.75e-18	93.6	1867	0.052	0.046	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
13	M0RAP5	6.78e-18	93.2	1893	0.052	0.045	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
14	O95248	8.55e-18	92.8	1868	0.052	0.046	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
15	A0A8I6AD51	1.87e-17	91.7	1875	0.042	0.037	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
16	O75064	1.81e-16	88.6	1496	0.061	0.068	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
17	A6H8H2	8.00e-15	83.2	1906	0.078	0.068	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
18	E9PXF8	1.56e-14	82.0	1872	0.041	0.036	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
19	Q86WG5	2.01e-14	81.6	1849	0.043	0.038	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
20	Q6ZUT9	4.28e-13	77.4	1274	0.026	0.034	DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02141 DENN	1.4e-29	114.8	DENN (AEX-3) domain
2	PF04618 HD-ZIP_N	1.2e+02	14.6	HD-ZIP protein N terminus
3	PF03456 uDENN	1e-10	53.3	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.986	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000379601	0.976	Ras-related protein Rab-27A
3	9606.ENSP00000222256	0.968	Ras-related protein Rab-3A
4	9606.ENSP00000262094	0.957	Ras-related protein Rab-27B
5	9606.ENSP00000441858	0.947	DmX-like protein 2
6	9606.ENSP00000398698	0.937	Tumor necrosis factor
7	9606.ENSP00000337797	0.930	P53-induced death domain-containing protein 1
8	9606.ENSP00000394071	0.916	Rab GDP dissociation inhibitor alpha
9	9606.ENSP00000263464	0.915	Baculoviral IAP repeat-containing protein 3
10	9606.ENSP00000351273	0.911	Caspase-8
11	9606.ENSP00000369538	0.910	Rab GDP dissociation inhibitor beta
12	9606.ENSP00000350386	0.909	Rab proteins geranylgeranyltransferase component A 1
13	9606.ENSP00000341268	0.908	Tumor necrosis factor receptor type 1-associated DEATH domain protein
14	9606.ENSP00000301838	0.907	FAS-associated death domain protein
15	9606.ENSP00000247668	0.906	TNF receptor-associated factor 2
16	9606.ENSP00000312664	0.906	Caspase-2
17	9606.ENSP00000355511	0.904	Rab proteins geranylgeranyltransferase component A 2
18	9606.ENSP00000411012	0.903	Protein FAN
19	9606.ENSP00000287322	0.902	BAG family molecular chaperone regulator 4
20	9606.ENSP00000340409	0.902	Sphingomyelin phosphodiesterase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0032813	0.908	tumor necrosis factor receptor superfamily binding
GO:0019887	0.900	protein kinase regulator activity
GO:0005123	0.898	death receptor binding
GO:0030295	0.891	protein kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0048523	0.969	negative regulation of cellular process
GO:0023051	0.965	regulation of signaling
GO:0010646	0.964	regulation of cell communication
GO:0048518	0.935	positive regulation of biological process
GO:0048522	0.914	positive regulation of cellular process
GO:0048583	0.890	regulation of response to stimulus
GO:0009966	0.868	regulation of signal transduction
GO:0010941	0.815	regulation of cell death
GO:1902533	0.810	positive regulation of intracellular signal transduction
GO:0006915	0.807	apoptotic process
GO:0023052	0.788	signaling
GO:0051179	0.782	localization
GO:0050896	0.772	response to stimulus
GO:0042981	0.768	regulation of apoptotic process
GO:0051234	0.764	establishment of localization
GO:0006810	0.747	transport
GO:0051641	0.734	cellular localization
GO:0032879	0.717	regulation of localization
GO:0023057	0.714	negative regulation of signaling
GO:0051649	0.702	establishment of localization in cell
GO:0046907	0.691	intracellular transport
GO:2001233	0.678	regulation of apoptotic signaling pathway
GO:0010648	0.656	negative regulation of cell communication
GO:0097194	0.646	execution phase of apoptosis
GO:0051726	0.643	regulation of cell cycle
GO:0051716	0.637	cellular response to stimulus
GO:0007154	0.618	cell communication
GO:0060341	0.585	regulation of cellular localization
GO:0051049	0.572	regulation of transport
GO:0051640	0.508	organelle localization
GO:0032880	0.494	regulation of protein localization
GO:0007165	0.490	signal transduction
GO:2001236	0.357	regulation of extrinsic apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.995	plasma membrane
GO:0043231	0.872	intracellular membrane-bounded organelle
GO:0012505	0.546	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]