StarFunc result for job id Q8WXG9

User Input

>input (1400 residues)
MSVFLGPGMPSASLLVNLLSALLILFVFGETEIRFTGQTEFVVNETSTTVIRLIIERIGE
PANVTAIVSLYGEDAGDFFDTYAAAFIPAGETNRTVYIAVCDDDLPEPDETFIFHLTLQK
PSANVKLGWPRTVTVTILSNDNAFGIISFNMLPSIAVSEPKGRNESMPLTLIREKGTYGM
VMVTFEVEGGPNPPDEDLSPVKGNITFPPGRATVIYNLTVLDDEVPENDEIFLIQLKSVE
GGAEINTSRNSIEIIIKKNDSPVRFLQSIYLVPEEDHILIIPVVRGKDNNGNLIGSDEYE
VSISYAVTTGNSTAHAQQNLDFIDLQPNTTVVFPPFIHESHLKFQIVDDTIPEIAESFHI
MLLKDTLQGDAVLISPSVVQVTIKPNDKPYGVLSFNSVLFERTVIIDEDRISRYEEITVV
RNGGTHGNVSANWVLTRNSTDPSPVTADIRPSSGVLHFAQGQMLATIPLTVVDDDLPEEA
EAYLLQILPHTIRGGAEVSEPAELLFYIQDSDDVYGLITFFPMENQKIESSPGERYLSLS
FTRLGGTKGDVRLLYSVLYIPAGAVDPLQAKEGILNISRRNDLIFPEQKTQVTTKLPIRN
DAFLQNGAHFLVQLETVELLNIIPLIPPISPRFGEICNISLLVTPAIANGEIGFLSNLPI
ILHEPEDFAAEVVYIPLHRDGTDGQATVYWSLKPSGFNSKAVTPDDIGPFNGSVLFLSGQ
SDTTINITIKGDDIPEMNETVTLSLDRVNVENQVLKSGYTSRDLIILENDDPGGVFEFSP
ASRGPYVIKEGESVELHIIRSRGSLVKQFLHYRVEPRDSNEFYGNTGVLEFKPGEREIVI
TLLARLDGIPELDEHYWVVLSSHGERESKLGSATIVNITILKNDDPHGIIEFVSDGLIVM
INESKGDAIYSAVYDVVRNRGNFGDVSVSWVVSPDFTQDVFPVQGTVVFGDQEFSKNITI
YSLPDEIPEEMEEFTVILLNGTGGAKVGNRTTATLRIRRNDDPIYFAEPRVVRVQEGETA
NFTVLRNGSVDVTCMVQYATKDGKATARERDFIPVEKGETLIFEVGSRQQSISIFVNEDG
IPETDEPFYIILLNSTGDTVVYQYGVATVIIEANDDPNGIFSLEPIDKAVEEGKTNAFWI
LRHRGYFGSVSVSWQLFQNDSALQPGQEFYETSGTVNFMDGEEAKPIILHAFPDKIPEFN
EFYFLKLVNISGGSPGPGGQLAETNLQVTVMVPFNDDPFGVFILDPECLEREVAEDVLSE
DDMSYITNFTILRQQGVFGDVQLGWEILSSEFPAGLPPMIDFLLVGIFPTTVHLQQHMRR
HHSGTDALYFTGLEGAFGTVNPKYHPSRNNTIANFTFSAWVMPNANTNGFIIAKDDGNGS
IYYGVKIQTNESHVTLSLHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8JFU2	0.111	0.084	6.017E-36	2118	0.133	0.088	A8JFU2.pdb.gz	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
2	AFDB:P0C091	0.150	0.105	1.241E-35	2139	0.122	0.080	P0C091.pdb.gz	FREM3_HUMAN FRAS1-related extracellular matrix protein 3 OS=Homo sapiens OX=9606 GN=FREM3 PE=3 SV=2
3	AFDB:Q5H8B9	0.139	0.099	2.585E-33	2123	0.121	0.080	Q5H8B9.pdb.gz	FREM3_MOUSE FRAS1-related extracellular matrix protein 3 OS=Mus musculus OX=10090 GN=Frem3 PE=2 SV=2
4	AFDB:Q5H8C1	0.127	0.092	9.453E-27	2179	0.131	0.084	Q5H8C1.pdb.gz	FREM1_HUMAN FRAS1-related extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=FREM1 PE=1 SV=3
5	AFDB:Q684R7	0.137	0.101	2.233E-26	2191	0.126	0.080	Q684R7.pdb.gz	FREM1_MOUSE FRAS1-related extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Frem1 PE=1 SV=1
6	PDB:7sqcO0	0.117	0.138	3.068E-26	1140	0.078	0.096	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
7	AFDB:F1R4B2	0.133	0.102	4.424E-25	2167	0.131	0.085	F1R4B2.pdb.gz
8	AFDB:Q57XV2	0.195	0.133	2.481E-23	2327	0.101	0.061	Q57XV2.pdb.gz	Q57XV2_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.770 PE=4 SV=1
9	AFDB:Q5ICW6	0.148	0.127	4.535E-20	1796	0.130	0.101	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
10	PDB:5a42A	0.103	0.094	5.467E-19	1597	0.097	0.085	5a42A.pdb.gz
11	AFDB:Q63041	0.094	0.089	6.255E-19	1500	0.079	0.073	Q63041.pdb.gz	A1M_RAT Alpha-1-macroglobulin OS=Rattus norvegicus OX=10116 GN=A1m PE=1 SV=1
12	AFDB:G5ECX2	0.114	0.129	3.822E-18	1187	0.091	0.107	G5ECX2.pdb.gz	G5ECX2_CAEEL Immunoglobulin domain-containing protein Y54G2A.25 OS=Caenorhabditis elegans OX=6239 GN=lad-2 PE=2 SV=1
13	PDB:7q1yA	0.096	0.097	1.421E-17	1374	0.070	0.071	7q1yA.pdb.gz
14	PDB:7vonA	0.115	0.115	3.512E-17	1399	0.089	0.089	7vonA.pdb.gz
15	PDB:7q5zA	0.093	0.096	4.229E-16	1344	0.066	0.069	7q5zA.pdb.gz
16	PDB:6h03A	0.089	0.097	9.549E-16	1223	0.071	0.081	6h03A.pdb.gz
17	PDB:4ziqA	0.092	0.090	1.970E-15	1450	0.085	0.082	4ziqA.pdb.gz
18	PDB:4lnvA	0.088	0.094	3.711E-15	1276	0.062	0.068	4lnvA.pdb.gz
19	PDB:7nycA	0.090	0.084	3.902E-14	1542	0.069	0.062	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:5oj2B	0.080	0.130	9.309E-12	692	0.069	0.139	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MK89	0.0	2367	6298	0.816	0.181	A0A096MK89_RAT Adhesion G protein-coupled receptor V1 OS=Rattus norvegicus OX=10116 GN=Adgrv1 PE=4 SV=1
2	A0A8I6A7V4	0.0	1420	866	0.492	0.796	A0A8I6A7V4_RAT Adhesion G protein-coupled receptor V1 OS=Rattus norvegicus OX=10116 GN=Adgrv1 PE=4 SV=1
3	Q6JAN0	0.0	1580	6199	0.545	0.123	AGRV1_DANRE Adhesion G-protein coupled receptor V1 OS=Danio rerio OX=7955 GN=adgrv1 PE=2 SV=1
4	Q8VHN7	0.0	2373	6298	0.822	0.183	AGRV1_MOUSE Adhesion G-protein coupled receptor V1 OS=Mus musculus OX=10090 GN=Adgrv1 PE=1 SV=1
5	Q8WXG9	0.0	2859	6306	1.000	0.222	AGRV1_HUMAN Adhesion G-protein coupled receptor V1 OS=Homo sapiens OX=9606 GN=ADGRV1 PE=1 SV=2
6	Q01728	6.21e-12	73.2	971	0.046	0.067	NAC1_RAT Sodium/calcium exchanger 1 OS=Rattus norvegicus OX=10116 GN=Slc8a1 PE=1 SV=3
7	P23685	1.01e-11	72.4	970	0.047	0.068	NAC1_CANLF Sodium/calcium exchanger 1 OS=Canis lupus familiaris OX=9615 GN=SLC8A1 PE=1 SV=1
8	P48766	1.11e-11	72.0	970	0.047	0.068	NAC1_CAVPO Sodium/calcium exchanger 1 OS=Cavia porcellus OX=10141 GN=SLC8A1 PE=2 SV=1
9	P48765	2.18e-11	71.2	970	0.047	0.068	NAC1_BOVIN Sodium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC8A1 PE=1 SV=1
10	P32418	2.28e-11	71.2	973	0.046	0.067	NAC1_HUMAN Sodium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC8A1 PE=1 SV=3
11	P70414	3.95e-11	70.5	970	0.043	0.062	NAC1_MOUSE Sodium/calcium exchanger 1 OS=Mus musculus OX=10090 GN=Slc8a1 PE=1 SV=1
12	A0A0B4LHD7	1.44e-08	62.0	955	0.047	0.069	A0A0B4LHD7_DROME Na/Ca-exchange protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
13	A0A0B4LHD9	2.82e-08	60.8	657	0.034	0.073	A0A0B4LHD9_DROME Na/Ca-exchange protein, isoform I OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
14	O35157	3.19e-08	60.8	940	0.041	0.062	O35157_MOUSE Sodium/calcium exchanger 1 OS=Mus musculus OX=10090 GN=Slc8a1 PE=1 SV=1
15	A0A0B4K6E2	4.20e-08	60.5	973	0.034	0.049	A0A0B4K6E2_DROME Na/Ca-exchange protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
16	A0A0B4K790	4.23e-08	60.5	963	0.033	0.048	A0A0B4K790_DROME Na/Ca-exchange protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
17	A0A0B4K6A6	4.37e-08	60.5	960	0.034	0.050	A0A0B4K6A6_DROME Na/Ca-exchange protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
18	Q24413	4.39e-08	60.5	950	0.034	0.051	Q24413_DROME Na/Ca exchange protein OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=2
19	Q9VDG5	4.39e-08	60.5	950	0.034	0.051	Q9VDG5_DROME AT07459p OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
20	A0A0B4K6R7	4.42e-08	60.5	950	0.047	0.069	A0A0B4K6R7_DROME Na/Ca-exchange protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03160 Calx-beta	3.9e-55	195.5	Calx-beta domain
2	PF13385 Laminin_G_3	67	15.0	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384582

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354623	0.996	Whirlin
2	9606.ENSP00000480489	0.978	PDZ domain-containing protein 7
3	9606.ENSP00000005226	0.968	Harmonin
4	9606.ENSP00000376048	0.920	Myelin-associated glycoprotein
5	9606.ENSP00000410083	0.899	Vezatin
6	9606.ENSP00000480279	0.874	Usher syndrome type-1G protein
7	9606.ENSP00000386331	0.866	Unconventional myosin-VIIa
8	9606.ENSP00000381768	0.865	Cadherin-23
9	9606.ENSP00000363068	0.852	Protocadherin-15
10	9606.ENSP00000305941	0.851	Usherin
11	9606.ENSP00000329158	0.822	Clarin-1
12	9606.ENSP00000258930	0.743	Calcium and integrin-binding family member 2
13	9606.ENSP00000295736	0.737	Sodium bicarbonate cotransporter 3
14	9606.ENSP00000354896	0.730	Metabotropic glutamate receptor 1
15	9606.ENSP00000346964	0.685	Pikachurin
16	9606.ENSP00000205890	0.661	Unconventional myosin-XV
17	9606.ENSP00000314518	0.659	LysM and putative peptidoglycan-binding domain-containing protein 3
18	9606.ENSP00000296526	0.658	Glutamate receptor 2
19	9606.ENSP00000278198	0.656	Leucine-rich repeat-containing protein 4C
20	9606.ENSP00000360472	0.654	Leucine-rich glioma-inactivated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0005509	0.989	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007600	0.997	sensory perception
GO:0065007	0.990	biological regulation
GO:0009987	0.923	cellular process
GO:0048513	0.887	animal organ development
GO:0050954	0.859	sensory perception of mechanical stimulus
GO:0050953	0.829	sensory perception of light stimulus
GO:0007605	0.788	sensory perception of sound
GO:0050793	0.778	regulation of developmental process
GO:0050794	0.770	regulation of cellular process
GO:0051716	0.756	cellular response to stimulus
GO:0042592	0.494	homeostatic process
GO:0007154	0.308	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0016020	0.972	membrane
GO:0043227	0.929	membrane-bounded organelle
GO:0005737	0.869	cytoplasm
GO:0043005	0.828	neuron projection
GO:0032991	0.800	protein-containing complex
GO:0071944	0.697	cell periphery
GO:0098858	0.690	actin-based cell projection
GO:0032421	0.675	stereocilium bundle
GO:0032420	0.665	stereocilium
GO:0030054	0.589	cell junction
GO:0005886	0.530	plasma membrane
GO:0045202	0.495	synapse
GO:0005576	0.483	extracellular region
GO:0043229	0.426	intracellular organelle
GO:0031982	0.322	vesicle
GO:0005615	0.317	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]