StarFunc result for job id Q8WXH4

User Input

>input (323 residues)
MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGIS
DCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLEN
GAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECME
ILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSN
VEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLG
RACHQAIHKLHLPEPLERFLLYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXH4	1.000	1.000	1.462E-46	323	1.000	1.000	Q8WXH4.pdb.gz	ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens OX=9606 GN=ASB11 PE=1 SV=1
2	AFDB:Q8WWX0	0.810	0.796	1.090E-29	329	0.545	0.535	Q8WWX0.pdb.gz	ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens OX=9606 GN=ASB5 PE=2 SV=1
3	AFDB:Q91ZT8	0.793	0.881	2.946E-25	290	0.452	0.503	Q91ZT8.pdb.gz	ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus OX=10090 GN=Asb9 PE=1 SV=2
4	AFDB:Q96DX5	0.773	0.848	3.216E-25	294	0.449	0.493	Q96DX5.pdb.gz	ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens OX=9606 GN=ASB9 PE=1 SV=1
5	AFDB:Q503N0	0.776	0.797	3.808E-23	314	0.402	0.414	Q503N0.pdb.gz
6	PDB:6v9hC	0.776	0.923	1.020E-22	270	0.452	0.541	6v9hC.pdb.gz
7	AFDB:Q8WXK3	0.775	0.897	1.537E-20	278	0.328	0.381	Q8WXK3.pdb.gz	ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens OX=9606 GN=ASB13 PE=1 SV=2
8	AFDB:Q9WV74	0.633	0.611	6.856E-15	336	0.241	0.232	Q9WV74.pdb.gz	ASB1_MOUSE Ankyrin repeat and SOCS box protein 1 OS=Mus musculus OX=10090 GN=Asb1 PE=2 SV=1
9	AFDB:Q9H672	0.646	0.655	6.242E-13	318	0.232	0.236	Q9H672.pdb.gz	ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens OX=9606 GN=ASB7 PE=1 SV=2
10	AFDB:E9Q9B7	0.640	0.124	2.323E-12	1793	0.229	0.041	E9Q9B7.pdb.gz	E9Q9B7_MOUSE Kinase D-interacting substrate 220 OS=Mus musculus OX=10090 GN=Kidins220 PE=1 SV=1
11	AFDB:A2ABF9	0.620	0.168	2.767E-12	1267	0.207	0.053	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
12	PDB:8cs9A	0.482	0.226	2.121E-11	796	0.238	0.097	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:2dvwA	0.608	0.844	3.067E-10	229	0.183	0.258	2dvwA.pdb.gz
14	PDB:4oauC	0.593	0.294	2.243E-8	692	0.186	0.087	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6aunA	0.410	0.250	7.990E-8	618	0.201	0.105	6aunA.pdb.gz
16	PDB:5vkqA	0.573	0.131	1.918E-7	1499	0.176	0.038	5vkqA.pdb.gz
17	PDB:6jd6B	0.264	0.429	3.866E-7	192	0.124	0.208	6jd6B.pdb.gz
18	PDB:1wg0A	0.589	0.768	6.259E-7	243	0.155	0.206	1wg0A.pdb.gz
19	PDB:6pqpA	0.487	0.266	4.694E-6	615	0.142	0.075	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:6mwqA	0.437	0.291	1.672E-5	493	0.146	0.095	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXH4	0.0	661	323	1.000	1.000	ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens OX=9606 GN=ASB11 PE=1 SV=1
2	Q8WWX0	2.20e-122	356	329	0.542	0.532	ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens OX=9606 GN=ASB5 PE=2 SV=1
3	Q96DX5	3.52e-96	288	294	0.452	0.497	ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens OX=9606 GN=ASB9 PE=1 SV=1
4	Q91ZT8	1.69e-95	286	290	0.452	0.503	ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus OX=10090 GN=Asb9 PE=1 SV=2
5	Q70X92	5.06e-76	236	293	0.409	0.451	Q70X92_DANRE Ankyrin repeat and SOCS box containing protein a OS=Danio rerio OX=7955 GN=asb-a PE=2 SV=1
6	Q8WXK3	1.32e-59	194	278	0.334	0.388	ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens OX=9606 GN=ASB13 PE=1 SV=2
7	A0A5F9ZH19	1.51e-23	103	3895	0.226	0.019	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	A0A5F9ZHF7	1.51e-23	103	3862	0.226	0.019	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A8JNM6	1.62e-23	103	4189	0.245	0.019	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	A8JNM7	1.62e-23	103	4114	0.245	0.019	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	Q7KU92	1.62e-23	103	4083	0.245	0.019	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
12	A8JNM5	1.63e-23	103	4264	0.245	0.019	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
13	M9MRR4	1.63e-23	103	4223	0.245	0.019	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	M9MRS5	1.63e-23	103	4496	0.245	0.018	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	M9MRX1	1.63e-23	103	4329	0.245	0.018	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	M9MS19	1.63e-23	103	4230	0.245	0.019	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	M9MSK6	1.63e-23	103	4352	0.245	0.018	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	M9PEN3	1.63e-23	103	4373	0.245	0.018	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	X2JC49	1.63e-23	103	4233	0.245	0.019	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	M9MRX4	1.69e-23	103	13559	0.245	0.006	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	7.2e-16	69.0	Ankyrin repeat
2	PF12796 Ank_2	1.5e-27	107.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	3.5e-24	93.1	Ankyrin repeat
4	PF13637 Ank_4	2.9e-21	86.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.8e-20	84.0	Ankyrin repeats (many copies)
6	PF11300 DUF3102	3.6e+02	12.8	Protein of unknown function (DUF3102)
7	PF07525 SOCS_box	2.2e-06	39.2	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417914

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.850	Cullin-5
2	9606.ENSP00000331556	0.769	Cylicin-1
3	9606.ENSP00000284142	0.760	Ankyrin repeat and SOCS box protein 17
4	9606.ENSP00000478121	0.723	Elongin-C
5	9606.ENSP00000262306	0.720	Elongin-B
6	9606.ENSP00000273480	0.675	RING-box protein 2
7	9606.ENSP00000359567	0.661	Transcription factor SOX-3
8	9606.ENSP00000250495	0.655	NEDD8
9	9606.ENSP00000317580	0.649	Neurogenin-1
10	9606.ENSP00000296255	0.639	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
11	9606.ENSP00000332791	0.627	Kelch-like protein 15
12	9606.ENSP00000354923	0.603	Dystrophin
13	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
14	9606.ENSP00000267935	0.600	COMM domain-containing protein 4
15	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
16	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
17	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
18	9606.ENSP00000348054	0.600	COMM domain containing 6
19	9606.ENSP00000365401	0.600	Coiled-coil domain-containing protein 22
20	9606.ENSP00000366032	0.600	COMM domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050789	0.984	regulation of biological process
GO:0009987	0.976	cellular process
GO:0071704	0.963	organic substance metabolic process
GO:0044238	0.895	primary metabolic process
GO:0050794	0.882	regulation of cellular process
GO:0006807	0.859	nitrogen compound metabolic process
GO:0043170	0.781	macromolecule metabolic process
GO:1901564	0.746	organonitrogen compound metabolic process
GO:0070647	0.725	protein modification by small protein conjugation or removal
GO:0044237	0.443	cellular metabolic process
GO:0019222	0.442	regulation of metabolic process
GO:0060255	0.395	regulation of macromolecule metabolic process
GO:0032446	0.359	protein modification by small protein conjugation
GO:0050896	0.336	response to stimulus
GO:0080090	0.307	regulation of primary metabolic process
GO:0051171	0.307	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0012505	0.936	endomembrane system
GO:0005783	0.505	endoplasmic reticulum
GO:0005634	0.304	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]