StarFunc result for job id Q8WXH5

User Input

>input (440 residues)
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXH5	1.000	1.000	2.962E-76	440	1.000	1.000	Q8WXH5.pdb.gz	SOCS4_HUMAN Suppressor of cytokine signaling 4 OS=Homo sapiens OX=9606 GN=SOCS4 PE=1 SV=1
2	AFDB:Q91ZA6	0.586	0.591	1.752E-64	436	0.866	0.874	Q91ZA6.pdb.gz	SOCS4_MOUSE Suppressor of cytokine signaling 4 OS=Mus musculus OX=10090 GN=Socs4 PE=2 SV=2
3	AFDB:O54928	0.402	0.331	1.341E-40	536	0.505	0.414	O54928.pdb.gz	SOCS5_MOUSE Suppressor of cytokine signaling 5 OS=Mus musculus OX=10090 GN=Socs5 PE=1 SV=2
4	AFDB:Q9JLY0	0.226	0.189	2.030E-13	533	0.250	0.206	Q9JLY0.pdb.gz	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
5	AFDB:O14544	0.226	0.190	8.114E-13	535	0.211	0.174	O14544.pdb.gz	SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2
6	PDB:8dcxB	0.203	0.358	5.532E-7	236	0.059	0.110	8dcxB.pdb.gz
7	PDB:1ka6A	0.172	0.598	1.614E-5	107	0.050	0.206	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
8	PDB:7myoB	0.177	0.263	2.053E-5	286	0.061	0.094	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
9	PDB:4fl2A	0.201	0.161	3.130E-5	555	0.055	0.043	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
10	PDB:1k9aB	0.207	0.206	4.493E-5	441	0.050	0.050	1k9aB.pdb.gz
11	PDB:4gwfA	0.171	0.152	6.449E-5	497	0.052	0.046	4gwfA.pdb.gz
12	PDB:3ps5A	0.161	0.135	8.206E-5	529	0.050	0.042	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:4k2rA	0.211	0.171	8.715E-5	551	0.064	0.051	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:3qwyA	0.184	0.439	9.256E-5	170	0.064	0.165	3qwyA.pdb.gz
15	PDB:1griA	0.193	0.379	2.025E-4	211	0.043	0.090	1griA.pdb.gz
16	AFDB:P78314	0.187	0.149	2.026E-4	561	0.136	0.107	P78314.pdb.gz	3BP2_HUMAN SH3 domain-binding protein 2 OS=Homo sapiens OX=9606 GN=SH3BP2 PE=1 SV=2
17	AFDB:E9Q0S6	0.191	0.050	1.747E-2	1888	0.132	0.031	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
18	AFDB:Q9HBL0	0.173	0.049	3.390E-2	1735	0.132	0.033	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
19	AFDB:P91399	0.077	0.042	1.507	926	0.105	0.050	P91399.pdb.gz	RMI1_CAEEL RecQ-mediated genome instability protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rmh-1 PE=1 SV=1
20	AFDB:A2QCJ9	0.066	0.068	2.441	427	0.082	0.084	A2QCJ9.pdb.gz	CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=creA PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXH5	0.0	918	440	1.000	1.000	SOCS4_HUMAN Suppressor of cytokine signaling 4 OS=Homo sapiens OX=9606 GN=SOCS4 PE=1 SV=1
2	Q91ZA6	0.0	787	436	0.866	0.874	SOCS4_MOUSE Suppressor of cytokine signaling 4 OS=Mus musculus OX=10090 GN=Socs4 PE=2 SV=2
3	O75159	2.05e-146	429	536	0.520	0.427	SOCS5_HUMAN Suppressor of cytokine signaling 5 OS=Homo sapiens OX=9606 GN=SOCS5 PE=1 SV=1
4	O54928	4.16e-146	429	536	0.518	0.425	SOCS5_MOUSE Suppressor of cytokine signaling 5 OS=Mus musculus OX=10090 GN=Socs5 PE=1 SV=2
5	Q9VJA1	3.17e-76	251	633	0.255	0.177	Q9VJA1_DROME Suppressor of cytokine signaling SOCS36E OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=2
6	Q86P82	3.27e-76	251	634	0.255	0.177	Q86P82_DROME SD04308p OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=2 SV=1
7	Q8INY1	1.22e-75	252	737	0.255	0.152	Q8INY1_DROME Suppressor of cytokine signaling at 36E, isoform D OS=Drosophila melanogaster OX=7227 GN=Socs36E PE=4 SV=2
8	O14544	6.56e-22	100	535	0.141	0.116	SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2
9	Q9JLY0	1.06e-21	99.8	533	0.141	0.116	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
10	V9Q6E2	1.14e-16	80.5	200	0.127	0.280	V9Q6E2_SALSA Suppressor of cytokine signaling 2a OS=Salmo salar OX=8030 GN=SOCS2a PE=2 SV=1
11	V9Q4K1	1.11e-15	77.4	200	0.120	0.265	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
12	O14508	3.38e-15	76.3	198	0.132	0.293	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
13	O70512	3.78e-15	77.4	256	0.120	0.207	CISH_RAT Cytokine-inducible SH2-containing protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Cish PE=2 SV=1
14	Q8VHQ2	1.26e-14	78.2	579	0.116	0.088	SOCS7_MOUSE Suppressor of cytokine signaling 7 OS=Mus musculus OX=10090 GN=Socs7 PE=1 SV=1
15	O14512	1.42e-14	78.2	581	0.116	0.088	SOCS7_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2
16	A0A087X1Q5	1.66e-14	77.8	553	0.116	0.092	A0A087X1Q5_HUMAN Suppressor of cytokine signaling 7 (Fragment) OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2
17	O88582	1.75e-14	73.9	198	0.130	0.288	SOCS2_RAT Suppressor of cytokine signaling 2 OS=Rattus norvegicus OX=10116 GN=Socs2 PE=2 SV=1
18	A0A5F9YLF9	1.93e-14	77.8	645	0.116	0.079	A0A5F9YLF9_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=1
19	O35717	2.63e-14	73.6	198	0.130	0.288	SOCS2_MOUSE Suppressor of cytokine signaling 2 OS=Mus musculus OX=10090 GN=Socs2 PE=1 SV=1
20	Q9VX18	8.24e-14	76.3	1016	0.123	0.053	Q9VX18_DROME Suppressor of cytokine signaling at 16D, isoform A OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	0.00012	33.5	SH2 domain
2	PF12610 SOCS	2.1e-18	77.8	Suppressor of cytokine signalling
3	PF07525 SOCS_box	2.5e-06	39.0	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378855

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478121	0.987	Elongin-C
2	9606.ENSP00000262306	0.936	Elongin-B
3	9606.ENSP00000371067	0.925	Tyrosine-protein kinase JAK2
4	9606.ENSP00000415151	0.904	Core-binding factor subunit beta
5	9606.ENSP00000300305	0.900	Runt-related transcription factor 1
6	9606.ENSP00000303830	0.868	Insulin receptor
7	9606.ENSP00000264657	0.861	Signal transducer and activator of transcription 3
8	9606.ENSP00000293328	0.843	Signal transducer and activator of transcription 5B
9	9606.ENSP00000341208	0.843	Signal transducer and activator of transcription 5A
10	9606.ENSP00000354394	0.843	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000343204	0.828	Tyrosine-protein kinase JAK1
12	9606.ENSP00000417273	0.820	Cytoplasmic protein NCK1
13	9606.ENSP00000304895	0.816	Insulin receptor substrate 1
14	9606.ENSP00000381992	0.816	Septin-7
15	9606.ENSP00000431885	0.807	Non-receptor tyrosine-protein kinase TYK2
16	9606.ENSP00000376808	0.800	Cullin-5
17	9606.ENSP00000361202	0.798	Insulin receptor substrate 4
18	9606.ENSP00000391676	0.795	Tyrosine-protein kinase JAK3
19	9606.ENSP00000341524	0.767	Septin-6
20	9606.ENSP00000479861	0.750	Septin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005102	0.646	signaling receptor binding
GO:0019899	0.334	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0010605	0.967	negative regulation of macromolecule metabolic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0051246	0.953	regulation of protein metabolic process
GO:0009966	0.952	regulation of signal transduction
GO:0042325	0.949	regulation of phosphorylation
GO:0001932	0.940	regulation of protein phosphorylation
GO:0009968	0.937	negative regulation of signal transduction
GO:0042058	0.928	regulation of epidermal growth factor receptor signaling pathway
GO:0042059	0.924	negative regulation of epidermal growth factor receptor signaling pathway
GO:0065009	0.920	regulation of molecular function
GO:0051172	0.912	negative regulation of nitrogen compound metabolic process
GO:0050790	0.911	regulation of catalytic activity
GO:0031324	0.909	negative regulation of cellular metabolic process
GO:0001933	0.896	negative regulation of protein phosphorylation
GO:0050730	0.895	regulation of peptidyl-tyrosine phosphorylation
GO:0010469	0.886	regulation of signaling receptor activity
GO:0006469	0.883	negative regulation of protein kinase activity
GO:0061097	0.848	regulation of protein tyrosine kinase activity
GO:0009987	0.823	cellular process
GO:0050732	0.812	negative regulation of peptidyl-tyrosine phosphorylation
GO:0050896	0.804	response to stimulus
GO:0048518	0.799	positive regulation of biological process
GO:0048522	0.717	positive regulation of cellular process
GO:0051716	0.706	cellular response to stimulus
GO:0023052	0.696	signaling
GO:0007154	0.696	cell communication
GO:0007165	0.658	signal transduction
GO:0009893	0.465	positive regulation of metabolic process
GO:0007166	0.439	cell surface receptor signaling pathway
GO:0010604	0.362	positive regulation of macromolecule metabolic process
GO:0051239	0.343	regulation of multicellular organismal process
GO:0042221	0.332	response to chemical
GO:0031325	0.331	positive regulation of cellular metabolic process
GO:0051173	0.324	positive regulation of nitrogen compound metabolic process
GO:0002682	0.311	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.446	protein-containing complex
GO:0043229	0.373	intracellular organelle
GO:0043231	0.362	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]