StarFunc result for job id Q8WXI2

User Input

>input (1034 residues)
MALIMEPVSKWSPSQVVDWMKGLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVSRI
GHQELILEAVDLLCALNYGLETENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKL
PNDFLTSVVDLIGAAKSLLAWLDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYET
ENKILHVCKTLSGVCDHIISLSSDPLVSQSAHLEVIQLANIKPSEGLGMYIKSTYDGLHV
ITGTTENSPADRCKKIHAGDEVIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSM
LTSAPALLKNMRWKPLALQPLIPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPAEP
YIPRDEKGNLPCEDLRGHMVGKPVHKGSESPNSFLDQEYRKRFNIVEEDTVLYCYEYEKG
RSSSQGRRESTPTYGKLRPISMPVEYNWVGDYEDPNKMKRDSRRENSLLRYMSNEKIAQE
EYMFQRNSKKDTGKKSKKKGDKSNSPTHYSLLPSLQMDALRQDIMGTPVPETTLYHTFQQ
SSLQHKSKKKNKGPIAGKSKRRISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKD
ASLYWYINEEDEKAEGFISLPEFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRW
LNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCAS
PYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSG
LHYLQTLPLEDSVFSDSAAISPEHRRQSTLPTQKCHLQDHYGPYPLAESERMQVLNGNGG
KPRSFTLPRDSGFNHCCLNAPVSACDPQDDVQPPEVEEEEEEEEEEGEAAGENIGEKSES
REEKLGDSLQDLYRALEQASLSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKS
TLKAREGEVAIIDKVLDNPDLTSKEFQQWKQMYLDLFLDICQNTTSNDPLSISSEVDVIT
SSLAHTHSYIETHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXI2	1.000	1.000	0.000	1034	1.000	1.000	Q8WXI2.pdb.gz	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
2	AFDB:G9CGD6	0.321	0.366	1.127E-74	899	0.444	0.511	G9CGD6.pdb.gz	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
3	AFDB:Q6P9H4	0.300	0.552	4.170E-48	555	0.301	0.560	Q6P9H4.pdb.gz	CNKR3_HUMAN Connector enhancer of kinase suppressor of ras 3 OS=Homo sapiens OX=9606 GN=CNKSR3 PE=1 SV=1
4	AFDB:E1JIT7	0.081	0.053	2.642E-7	1601	0.121	0.078	E1JIT7.pdb.gz	PSD_DROME PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2
5	AFDB:O43166	0.085	0.053	5.498E-6	1804	0.139	0.080	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
6	AFDB:Q8C0T5	0.076	0.047	8.736E-6	1782	0.135	0.079	Q8C0T5.pdb.gz	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
7	AFDB:A0A0R4IZU1	0.091	0.072	9.683E-6	1347	0.120	0.092	A0A0R4IZU1.pdb.gz
8	PDB:6bbpA	0.090	0.177	1.385E-5	520	0.029	0.058	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
9	AFDB:Q9UPX8	0.090	0.066	1.990E-5	1470	0.113	0.080	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
10	PDB:3ljuX	0.084	0.222	2.438E-5	373	0.020	0.056	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
11	PDB:6t36A	0.081	0.803	1.723E-4	93	0.019	0.215	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
12	PDB:6u3eA	0.088	0.218	3.194E-4	397	0.028	0.073	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
13	AFDB:Q80Z38	0.087	0.062	3.371E-4	1476	0.103	0.072	Q80Z38.pdb.gz	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
14	PDB:6hhgA	0.088	0.228	5.075E-4	386	0.019	0.052	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
15	AFDB:A0A0R4IS11	0.086	0.065	5.357E-4	1565	0.106	0.070	A0A0R4IS11.pdb.gz
16	PDB:7pc3A	0.081	0.201	1.043E-3	405	0.025	0.064	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:2xkxA	0.080	0.115	1.098E-3	721	0.019	0.028	2xkxA.pdb.gz
18	PDB:7p70A	0.081	0.201	1.420E-3	407	0.017	0.044	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:4mk0A	0.098	0.156	1.495E-3	631	0.016	0.027	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:4uudC	0.083	0.614	1.837E-3	113	0.018	0.168	4uudC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G9CGD6	0.0	710	899	0.367	0.422	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
2	Q6P9H4	0.0	565	555	0.289	0.539	CNKR3_HUMAN Connector enhancer of kinase suppressor of ras 3 OS=Homo sapiens OX=9606 GN=CNKSR3 PE=1 SV=1
3	Q80YA9	0.0	2125	1032	0.986	0.988	CNKR2_MOUSE Connector enhancer of kinase suppressor of ras 2 OS=Mus musculus OX=10090 GN=Cnksr2 PE=1 SV=1
4	Q8BMA3	0.0	557	555	0.286	0.533	CNKR3_MOUSE Connector enhancer of kinase suppressor of ras 3 OS=Mus musculus OX=10090 GN=Cnksr3 PE=1 SV=1
5	Q8WXI2	0.0	2153	1034	1.000	1.000	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
6	Q9Z1T4	0.0	2129	1032	0.990	0.992	CNKR2_RAT Connector enhancer of kinase suppressor of ras 2 OS=Rattus norvegicus OX=10116 GN=Cnksr2 PE=1 SV=1
7	Q80VL0	3.45e-82	275	406	0.158	0.401	ICEF1_RAT Interactor protein for cytohesin exchange factors 1 OS=Rattus norvegicus OX=10116 GN=Ipcef1 PE=1 SV=1
8	Q7KNQ9	7.41e-51	198	1557	0.105	0.070	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1
9	Q8WWN9	3.01e-48	180	437	0.077	0.183	ICEF1_HUMAN Interactor protein for cytohesin exchange factors 1 OS=Homo sapiens OX=9606 GN=IPCEF1 PE=1 SV=1
10	Q969H4	7.57e-48	185	720	0.113	0.163	CNKR1_HUMAN Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1 PE=1 SV=1
11	A0A0N4SUU0	4.47e-14	79.3	956	0.044	0.048	A0A0N4SUU0_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
12	Q6ZPK1	5.09e-14	79.3	1205	0.044	0.038	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
13	A0A0N4SWD7	5.38e-14	79.3	1000	0.044	0.046	A0A0N4SWD7_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
14	A0A0N4SUV0	5.84e-14	78.2	525	0.044	0.088	A0A0N4SUV0_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
15	A0A0N4SW19	7.01e-14	78.2	531	0.044	0.087	A0A0N4SW19_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
16	E9Q6H8	7.22e-14	79.0	1269	0.044	0.036	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
17	B4DJX4	9.99e-14	78.2	977	0.041	0.043	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
18	Q9HAU0	1.61e-13	77.8	1116	0.041	0.038	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
19	B6RSP1	8.37e-13	75.5	1197	0.033	0.028	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
20	Q9Y2H5	1.61e-10	67.8	1048	0.040	0.039	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10377 ATG11	2.4e+02	13.2	Autophagy-related protein 11
2	PF06663 CNK2_3_dom	1.1e-59	213.1	Connector enhancer of kinase suppressor of ras 2/3 domain
3	PF10534 CRIC_ras_sig	2.9e-36	134.8	Connector enhancer of kinase suppressor of ras
4	PF00595 PDZ	1.9e-05	36.2	PDZ domain
5	PF13180 PDZ_2	1.4e+02	14.3	PDZ domain
6	PF17820 PDZ_6	0.016	26.4	PDZ domain
7	PF02163 Peptidase_M50	4.7e+02	11.4	Peptidase family M50
8	PF00169 PH	2.3e-11	55.5	PH domain
9	PF20399 PH_20	3e+02	12.9	PH domain
10	PF14593 PH_3	3.2e+02	12.7	PH domain
11	PF00536 SAM_1	1.1e-16	72.4	SAM domain (Sterile alpha motif)
12	PF07647 SAM_2	1e-10	52.9	SAM domain (Sterile alpha motif)
13	PF02198 SAM_PNT	60	15.0	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381958	0.936	Kinase suppressor of Ras 1
2	9606.ENSP00000251849	0.935	RAF proto-oncogene serine/threonine-protein kinase
3	9606.ENSP00000261313	0.902	Phosphatidylethanolamine-binding protein 1
4	9606.ENSP00000366522	0.888	Rho GTPase activating protein 39
5	9606.ENSP00000407586	0.880	GTPase HRas
6	9606.ENSP00000256078	0.832	GTPase KRas
7	9606.ENSP00000314173	0.829	Sterile alpha motif domain containing 12
8	9606.ENSP00000358548	0.828	GTPase NRas
9	9606.ENSP00000005257	0.819	Ras-related protein Ral-A
10	9606.ENSP00000290277	0.780	Serine/threonine-protein kinase A-Raf
11	9606.ENSP00000288602	0.773	Serine/threonine-protein kinase B-raf
12	9606.ENSP00000296318	0.748	Interleukin-17 receptor D
13	9606.ENSP00000302486	0.729	Dual specificity mitogen-activated protein kinase kinase 1
14	9606.ENSP00000262948	0.725	Dual specificity mitogen-activated protein kinase kinase 2
15	9606.ENSP00000389715	0.721	Kinase suppressor of Ras 2
16	9606.ENSP00000263025	0.717	Mitogen-activated protein kinase 3
17	9606.ENSP00000215832	0.714	Mitogen-activated protein kinase 1
18	9606.ENSP00000463574	0.687	Lysophosphatidic acid phosphatase type 6
19	9606.ENSP00000035383	0.678	Leucine-rich repeat-containing protein 7
20	9606.ENSP00000403636	0.654	Ras/Rap GTPase-activating protein SynGAP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019900	0.959	kinase binding
GO:0019901	0.953	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.954	response to stimulus
GO:0071840	0.858	cellular component organization or biogenesis
GO:0016043	0.850	cellular component organization
GO:0023052	0.815	signaling
GO:0034330	0.792	cell junction organization
GO:0051716	0.790	cellular response to stimulus
GO:0007154	0.753	cell communication
GO:0007165	0.684	signal transduction
GO:0099173	0.559	postsynapse organization
GO:0048583	0.484	regulation of response to stimulus
GO:0009966	0.426	regulation of signal transduction
GO:0048518	0.334	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0030054	0.998	cell junction
GO:0005886	0.998	plasma membrane
GO:0043227	0.992	membrane-bounded organelle
GO:0005737	0.990	cytoplasm
GO:0005576	0.979	extracellular region
GO:0045202	0.973	synapse
GO:0005829	0.968	cytosol
GO:0043229	0.957	intracellular organelle
GO:0031982	0.952	vesicle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0099572	0.947	postsynaptic specialization
GO:0098984	0.937	neuron to neuron synapse
GO:0070062	0.918	extracellular exosome
GO:0032279	0.917	asymmetric synapse
GO:0014069	0.900	postsynaptic density
GO:0012505	0.556	endomembrane system
GO:0070013	0.494	intracellular organelle lumen
GO:0031981	0.452	nuclear lumen
GO:0098978	0.386	glutamatergic synapse
GO:0032991	0.349	protein-containing complex
GO:0043232	0.323	intracellular non-membrane-bounded organelle
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]