StarFunc result for job id Q8WXI7

User Input

>input (1400 residues)
MLKPSGLPGSSSPTRSLMTGSRSTKATPEMDSGLTGATLSPKTSTGAIVVTEHTLPFTSP
DKTLASPTSSVVGRTTQSLGVMSSALPESTSRGMTHSEQRTSPSLSPQVNGTPSRNYPAT
SMVSGLSSPRTRTSSTEGNFTKEASTYTLTVETTSGPVTEKYTVPTETSTTEGDSTETPW
DTRYIPVKITSPMKTFADSTASKENAPVSMTPAETTVTDSHTPGRTNPSFGTLYSSFLDL
SPKGTPNSRGETSLELILSTTGYPFSSPEPGSAGHSRISTSAPLSSSASVLDNKISETSI
FSGQSLTSPLSPGVPEARASTMPNSAIPFSMTLSNAETSAERVRSTISSLGTPSISTKQT
AETILTFHAFAETMDIPSTHIAKTLASEWLGSPGTLGGTSTSALTTTSPSTTLVSEETNT
HHSTSGKETEGTLNTSMTPLETSAPGEESEMTATLVPTLGFTTLDSKIRSPSQVSSSHPT
RELRTTGSTSGRQSSSTAAHGSSDILRATTSSTSKASSWTSESTAQQFSEPQHTQWVETS
PSMKTERPPASTSVAAPITTSVPSVVSGFTTLKTSSTKGIWLEETSADTLIGESTAGPTT
HQFAVPTGISMTGGSSTRGSQGTTHLLTRATASSETSADLTLATNGVPVSVSPAVSKTAA
GSSPPGGTKPSYTMVSSVIPETSSLQSSAFREGTSLGLTPLNTRHPFSSPEPDSAGHTKI
STSIPLLSSASVLEDKVSATSTFSHHKATSSITTGTPEISTKTKPSSAVLSSMTLSNAAT
SPERVRNATSPLTHPSPSGEETAGSVLTLSTSAETTDSPNIHPTGTLTSESSESPSTLSL
PSVSGVKTTFSSSTPSTHLFTSGEETEETSNPSVSQPETSVSRVRTTLASTSVPTPVFPT
MDTWPTRSAQFSSSHLVSELRATSSTSVTNSTGSALPKISHLTGTATMSQTNRDTFNDSA
APQSTTWPETSPRFKTGLPSATTTVSTSATSLSATVMVSKFTSPATSSMEATSIREPSTT
ILTTETTNGPGSMAVASTNIPIGKGYITEGRLDTSHLPIGTTASSETSMDFTMAKESVSM
SVSPSQSMDAAGSSTPGRTSQFVDTFSDDVYHLTSREITIPRDGTSSALTPQMTATHPPS
PDPGSARSTWLGILSSSPSSPTPKVTMSSTFSTQRVTTSMIMDTVETSRWNMPNLPSTTS
LTPSNIPTSGAIGKSTLVPLDTPSPATSLEASEGGLPTLSTYPESTNTPSIHLGAHASSE
SPSTIKLTMASVVKPGSYTPLTFPSIETHIHVSTARMAYSSGSSPEMTAPGETNTGSTWD
PTTYITTTDPKDTSSAQVSTPHSVRTLRTTENHPKTESATPAAYSGSPKISSSPNLTSPA
TKAWTITDTTEHSTQLHYTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15069	0.037	0.034	3.561E-2	1562	0.181	0.163	O15069.pdb.gz	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
2	AFDB:Q9NZ56	0.041	0.035	8.895E-2	1722	0.153	0.124	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
3	AFDB:Q9VR13	0.028	0.031	1.466E-1	1136	0.171	0.211	Q9VR13.pdb.gz	Q9VR13_DROME Basic proline-rich protein-like OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15635 PE=4 SV=4
4	AFDB:Q9QXN0	0.033	0.026	3.099E-1	1986	0.176	0.124	Q9QXN0.pdb.gz	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
5	AFDB:Q5PSV9	0.031	0.027	3.368E-1	1707	0.180	0.148	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
6	AFDB:F1LRJ1	0.029	0.025	4.324E-1	1671	0.146	0.123	F1LRJ1.pdb.gz	F1LRJ1_RAT Collagen type IV alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col4a3 PE=4 SV=2
7	AFDB:P21519	0.033	0.030	6.031E-1	1594	0.121	0.107	P21519.pdb.gz	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2
8	AFDB:Q14676	0.030	0.022	7.124E-1	2089	0.199	0.133	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
9	AFDB:Q92954	0.029	0.029	7.124E-1	1404	0.135	0.135	Q92954.pdb.gz	PRG4_HUMAN Proteoglycan 4 OS=Homo sapiens OX=9606 GN=PRG4 PE=1 SV=3
10	AFDB:Q02952	0.033	0.029	8.414E-1	1782	0.163	0.128	Q02952.pdb.gz	AKA12_HUMAN A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXI7	0.0	2677	14507	1.000	0.097	MUC16_HUMAN Mucin-16 OS=Homo sapiens OX=9606 GN=MUC16 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372313	0.996	Mesothelin
2	9606.ENSP00000413861	0.992	Sialic acid-binding Ig-like lectin 9
3	9606.ENSP00000417498	0.988	Mucin-4
4	9606.ENSP00000485659	0.984	Mucin-5AC
5	9606.ENSP00000436812	0.982	Mucin-5B
6	9606.ENSP00000254301	0.981	Galectin-3
7	9606.ENSP00000484824	0.980	Mucin-1
8	9606.ENSP00000406861	0.977	Mucin-6
9	9606.ENSP00000414350	0.977	Mucin-20
10	9606.ENSP00000416753	0.976	Mucin-15
11	9606.ENSP00000441929	0.975	Mucin-12
12	9606.ENSP00000302716	0.974	Mucin-17
13	9606.ENSP00000485028	0.973	Mucin-13
14	9606.ENSP00000407422	0.971	Mucin-7
15	9606.ENSP00000368771	0.968	Mucin-3A
16	9606.ENSP00000365473	0.966	Mucin-21
17	9606.ENSP00000356042	0.952	Ezrin
18	9606.ENSP00000389176	0.948	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
19	9606.ENSP00000304364	0.944	C1GALT1-specific chaperone 1
20	9606.ENSP00000269195	0.942	Polypeptide N-acetylgalactosaminyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.526	multicellular organismal process
GO:0003008	0.369	system process
GO:0050789	0.300	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005796	1.000	Golgi lumen
GO:0005886	0.999	plasma membrane
GO:0070062	0.996	extracellular exosome
GO:0019898	0.980	extrinsic component of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]