StarFunc result for job id Q8WXR4

User Input

>input (1341 residues)
MKHLYGLFHYNPMMLGLESLPDPTDTWEIIETIGKGTYGKVYKVTNKRDGSLAAVKILDP
VSDMDEEIEAEYNILQFLPNHPNVVKFYGMFYKADHCVGGQLWLVLELCNGGSVTELVKG
LLRCGQRLDEAMISYILYGALLGLQHLHNNRIIHRDVKGNNILLTTEGGVKLVDFGVSAQ
LTSTRLRRNTSVGTPFWMAPEVIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFDMH
PVKTLFKIPRNPPPTLLHPEKWCEEFNHFISQCLIKDFERRPSVTHLLDHPFIKGVHGKV
LFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTII
HQLQKRYADLLIYTYVGDILIALNPFQNLSIYSPQFSRLYHGVKRASNPPHIFASADAAY
QCMVTLSKDQCIVISGESGSGKTESAHLIVQHLTFLGKANNQTLREKILQVNSLVEAFGN
SCTAINDNSSRFGKYLEMMFTPTGVVMGARISEYLLEKSRVIKQAAREKNFHIFYYIYAG
LHHQKKLSDFRLPEEKPPRYIADETGRVMHDITSKESYRRQFEAIQHCFRIIGFTDKEVH
SVYRILAGILNIGNIEFAAISSQHQTDKSEVPNAEALQNAASVLCISPEELQEALTSHCV
VTRGETIIRANTVDRAADVRDAMSKALYGRLFSWIVNRINTLLQPDENICSAGGGMNVGI
LDIFGFENFQRNSFEQLCINIANEQIQYYFNQHVFALEQMEYQNEGIDAVPVEYEDNRPL
LDMFLQKPLGLLALLDEESRFPQATDQTLVDKFEDNLRCKYFWRPKGVELCFGIQHYAGK
VLYDASGVLEKNRDTLPADVVVVLRTSENKLLQQLFSIPLTKTGNLAQTRARITVASSSL
PPHFSAGKAKVDTLEVIRHPEETTNMKRQTVASYFRYSLMDLLSKMVVGQPHFVRCIKPN
DDREALQFSRERVLAQLRSTGILETVSIRRQGYSHRILFEEFVKRYYYLAFTAHQTPLAS
KESCVAILEKSRLDHWVLGKTKVFLKYYHVEQLNLLLREVIGRVVVLQAYTKGWLGARRY
KRVREKREKGAIAIQSAWRGYDARRKFKKISNRRNESAAHNQAGDTSNQSSGPHSPVAAG
TRGSAEVQDCSEPGDHKVLRGSVHRRSHSQAESNNGRTQTSSNSPAVTEKNGHSQAQSSP
KGCDIFAGHANKHSVSGTDLLSSRICHPAPDQQGLSLWGAPQKPGSENGLAQKHRTPRRR
CQQPKMLSSPEDTMYYNQLNGTLEYQGSKRKPRKLGQIKVLDGEDEYYKSLSPVDCIPEE
NNSAHPSFFSSSSKGDSFAQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1EG27	0.578	0.593	0.000	1305	0.846	0.869	Q1EG27.pdb.gz	MYO3B_MOUSE Myosin-IIIb OS=Mus musculus OX=10090 GN=Myo3b PE=1 SV=2
2	AFDB:Q8K3H5	0.571	0.477	0.000	1613	0.559	0.464	Q8K3H5.pdb.gz	MYO3A_MOUSE Myosin-IIIa OS=Mus musculus OX=10090 GN=Myo3a PE=1 SV=1
3	AFDB:Q8NEV4	0.571	0.477	0.000	1616	0.556	0.461	Q8NEV4.pdb.gz	MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens OX=9606 GN=MYO3A PE=1 SV=2
4	AFDB:Q8WXR4	1.000	1.000	0.000	1341	1.000	1.000	Q8WXR4.pdb.gz	MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens OX=9606 GN=MYO3B PE=1 SV=4
5	AFDB:P10676	0.497	0.445	3.212E-83	1501	0.301	0.268	P10676.pdb.gz	NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster OX=7227 GN=ninaC PE=1 SV=2
6	AFDB:Q9Z1N3	0.473	0.248	5.150E-62	2626	0.248	0.126	Q9Z1N3.pdb.gz	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
7	AFDB:Q9Y6X6	0.491	0.358	2.012E-60	1858	0.230	0.166	Q9Y6X6.pdb.gz	MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens OX=9606 GN=MYO16 PE=1 SV=3
8	AFDB:E7EZG2	0.479	0.260	6.526E-60	2522	0.249	0.132	E7EZG2.pdb.gz	MY9AA_DANRE Unconventional myosin-IXAa OS=Danio rerio OX=7955 GN=myo9aa PE=3 SV=1
9	AFDB:Q5DU14	0.496	0.351	2.117E-59	1919	0.226	0.158	Q5DU14.pdb.gz	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
10	AFDB:Q03479	0.434	0.572	9.053E-58	1005	0.208	0.278	Q03479.pdb.gz	MYOE_DICDI Myosin IE heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoE PE=1 SV=2
11	PDB:4anjA	0.442	0.589	1.494E-48	995	0.169	0.227	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:4pa0A	0.399	0.541	3.081E-48	974	0.179	0.246	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.401	0.575	5.549E-48	920	0.178	0.260	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.484	0.778	6.107E-47	817	0.159	0.261	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.402	0.558	1.738E-45	952	0.173	0.244	4p7hB.pdb.gz
16	PDB:7mf3B	0.460	0.674	1.867E-40	896	0.195	0.292	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.437	0.597	3.536E-39	954	0.188	0.264	5tbyA.pdb.gz
18	PDB:3eqdA	0.184	0.738	9.811E-17	315	0.068	0.289	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
19	PDB:4eomC	0.170	0.770	2.129E-15	276	0.061	0.297	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:5u6yA	0.181	0.502	1.361E-14	459	0.057	0.168	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P10676	0.0	637	1501	0.283	0.252	NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster OX=7227 GN=ninaC PE=1 SV=2
2	Q1EG27	0.0	2339	1305	0.845	0.868	MYO3B_MOUSE Myosin-IIIb OS=Mus musculus OX=10090 GN=Myo3b PE=1 SV=2
3	Q8K3H5	0.0	1497	1613	0.533	0.443	MYO3A_MOUSE Myosin-IIIa OS=Mus musculus OX=10090 GN=Myo3a PE=1 SV=1
4	Q8NEV4	0.0	1528	1616	0.537	0.446	MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens OX=9606 GN=MYO3A PE=1 SV=2
5	Q8WXR4	0.0	2808	1341	1.000	1.000	MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens OX=9606 GN=MYO3B PE=1 SV=4
6	Q9DG88	0.0	1548	1838	0.547	0.399	Q9DG88_MORSA Myosin heavy chain FM3A OS=Morone saxatilis OX=34816 GN=FM3A PE=2 SV=1
7	Q6PIF6	7.21e-160	531	2116	0.229	0.145	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
8	Q99MZ6	2.89e-156	521	2113	0.225	0.143	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
9	Q9DGG9	1.39e-155	520	2179	0.230	0.141	Q9DGG9_DANRE Myosin VIIA OS=Danio rerio OX=7955 GN=myo7A PE=2 SV=1
10	Q13402	2.00e-153	514	2215	0.222	0.135	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
11	P97479	2.35e-152	511	2215	0.221	0.134	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
12	Q8CJE3	6.64e-151	506	2177	0.221	0.136	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
13	A0A8J8XYU9	8.76e-151	506	2215	0.221	0.134	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
14	A0A8I5ZWB0	1.04e-150	506	2238	0.221	0.132	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
15	Q8IPH6	1.53e-149	482	1033	0.225	0.292	Q8IPH6_DROME FI20293p1 OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=2
16	Q8IPH7	1.75e-149	481	1034	0.225	0.292	Q8IPH7_DROME Myosin 28B1, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=2
17	Q7YU72	2.01e-149	481	1035	0.225	0.292	Q7YU72_DROME RH39293p OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1
18	A0A0G2JTE7	9.30e-149	503	3494	0.237	0.091	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
19	A0A0G2K1F7	9.33e-149	503	3512	0.237	0.091	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
20	Q9QZZ4	1.27e-147	499	3511	0.232	0.089	MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.2e+02	13.6	AAA ATPase domain
2	PF13401 AAA_22	21	16.8	AAA domain
3	PF03109 ABC1	3.1	18.4	ABC1 atypical kinase-like domain
4	PF00005 ABC_tran	2.9e+02	13.4	ABC transporter
5	PF01636 APH	0.17	23.3	Phosphotransferase enzyme family
6	PF01583 APS_kinase	2e+02	13.3	Adenylylsulphate kinase
7	PF00612 IQ	0.0061	27.2	IQ calmodulin-binding motif
8	PF14531 Kinase-like	0.71	20.7	Kinase-like
9	PF00063 Myosin_head	1e-202	686.7	Myosin head (motor domain)
10	PF00069 Pkinase	8.1e-55	197.6	Protein kinase domain
11	PF17667 Pkinase_fungal	0.028	24.8	Fungal protein kinase
12	PF07714 PK_Tyr_Ser-Thr	2.2e-38	143.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386213

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367059	0.889	Espin
2	9606.ENSP00000307636	0.832	MORN repeat-containing protein 4
3	9606.ENSP00000291231	0.814	Olfactory receptor 3A3
4	9606.ENSP00000319197	0.796	Olfactory receptor 4K17
5	9606.ENSP00000386180	0.753	Olfactory receptor 3A2
6	9606.ENSP00000256538	0.727	Diphthine--ammonia ligase
7	9606.ENSP00000339115	0.725	Espin-like protein
8	9606.ENSP00000278590	0.715	Probable ribonuclease ZC3H12C
9	9606.ENSP00000280295	0.714	Protein phosphatase 1 regulatory subunit 1C
10	9606.ENSP00000296785	0.711	Ankyrin repeat family A protein 2
11	9606.ENSP00000385545	0.688	Kinesin-like protein KIF26B
12	9606.ENSP00000297405	0.682	CUB and sushi domain-containing protein 3
13	9606.ENSP00000344488	0.670	Junctophilin-1
14	9606.ENSP00000361883	0.664	Adenylyl cyclase-associated protein 1
15	9606.ENSP00000264784	0.660	Solute carrier family 2, facilitated glucose transporter member 9
16	9606.ENSP00000377197	0.657	Hydrocephalus-inducing protein homolog
17	9606.ENSP00000305071	0.652	DNA-binding protein RFXANK
18	9606.ENSP00000364430	0.650	Transcription factor Sp5
19	9606.ENSP00000370372	0.614	Neurolysin, mitochondrial
20	9606.ENSP00000362481	0.598	Uracil phosphoribosyltransferase homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003824	0.980	catalytic activity
GO:0000146	0.979	microfilament motor activity
GO:0140096	0.951	catalytic activity, acting on a protein
GO:0016740	0.948	transferase activity
GO:0016773	0.938	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.935	kinase activity
GO:0004672	0.934	protein kinase activity
GO:0004674	0.559	protein serine/threonine kinase activity
GO:0035639	0.324	purine ribonucleoside triphosphate binding
GO:0032559	0.324	adenyl ribonucleotide binding
GO:0005524	0.307	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0032501	0.958	multicellular organismal process
GO:0050794	0.958	regulation of cellular process
GO:0071704	0.933	organic substance metabolic process
GO:0071840	0.903	cellular component organization or biogenesis
GO:0043170	0.896	macromolecule metabolic process
GO:0043412	0.892	macromolecule modification
GO:0016043	0.883	cellular component organization
GO:0006807	0.846	nitrogen compound metabolic process
GO:0044238	0.845	primary metabolic process
GO:0044237	0.842	cellular metabolic process
GO:1901564	0.825	organonitrogen compound metabolic process
GO:0016310	0.815	phosphorylation
GO:0048856	0.802	anatomical structure development
GO:0019538	0.802	protein metabolic process
GO:0006468	0.775	protein phosphorylation
GO:0048518	0.768	positive regulation of biological process
GO:0007600	0.756	sensory perception
GO:0007275	0.744	multicellular organism development
GO:0050954	0.739	sensory perception of mechanical stimulus
GO:0048522	0.735	positive regulation of cellular process
GO:0065008	0.659	regulation of biological quality
GO:0051128	0.653	regulation of cellular component organization
GO:0060119	0.527	inner ear receptor cell development
GO:0042491	0.511	inner ear auditory receptor cell differentiation
GO:0120035	0.506	regulation of plasma membrane bounded cell projection organization
GO:0044087	0.492	regulation of cellular component biogenesis
GO:0042472	0.488	inner ear morphogenesis
GO:0007605	0.463	sensory perception of sound
GO:0120032	0.446	regulation of plasma membrane bounded cell projection assembly
GO:0031175	0.441	neuron projection development
GO:0048667	0.436	cell morphogenesis involved in neuron differentiation
GO:0060122	0.397	inner ear receptor cell stereocilium organization
GO:0002093	0.384	auditory receptor cell morphogenesis
GO:0090066	0.357	regulation of anatomical structure size
GO:0090102	0.350	cochlea development
GO:0051489	0.350	regulation of filopodium assembly
GO:0046777	0.346	protein autophosphorylation
GO:0018193	0.319	peptidyl-amino acid modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005737	0.998	cytoplasm
GO:0120025	0.994	plasma membrane bounded cell projection
GO:0005829	0.966	cytosol
GO:0043227	0.963	membrane-bounded organelle
GO:0043232	0.938	intracellular non-membrane-bounded organelle
GO:0098858	0.910	actin-based cell projection
GO:0016020	0.851	membrane
GO:0030175	0.849	filopodium
GO:0098862	0.820	cluster of actin-based cell projections
GO:0032421	0.813	stereocilium bundle
GO:0043005	0.808	neuron projection
GO:0032433	0.798	filopodium tip
GO:0032420	0.733	stereocilium
GO:0032426	0.716	stereocilium tip
GO:0015629	0.628	actin cytoskeleton
GO:0043231	0.568	intracellular membrane-bounded organelle
GO:0032991	0.433	protein-containing complex
GO:0071944	0.433	cell periphery
GO:0001917	0.328	photoreceptor inner segment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.979	myosin ATPase.
EC:2.-.-.-	0.948	Transferases.
EC:2.7.1.-	0.938	Phosphotransferases with an alcohol group as acceptor.

[back to server]