StarFunc result for job id Q8WXS5

User Input

>input (425 residues)
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY
LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY
ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRS
DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG
GASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR
KTTPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXS5	0.999	0.999	5.384E-58	425	1.000	1.000	Q8WXS5.pdb.gz	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
2	AFDB:O60359	0.490	0.656	4.867E-29	315	0.428	0.578	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
3	PDB:7ocaI	0.416	0.942	1.701E-24	185	0.421	0.968	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
4	PDB:5weoA	0.421	0.185	8.744E-18	988	0.311	0.134	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
5	PDB:5kbtA	0.379	0.177	3.093E-16	973	0.308	0.135	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
6	PDB:7rz4A	0.394	0.175	1.757E-12	993	0.151	0.064	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
7	PDB:5kk2E	0.331	0.710	2.084E-9	173	0.273	0.671	5kk2E.pdb.gz
8	PDB:7rzaA	0.363	0.164	1.949E-7	981	0.099	0.043	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
9	PDB:6jp5E	0.304	0.720	1.007E-5	169	0.092	0.231	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
10	PDB:6ov2A	0.314	0.662	1.925E-5	182	0.073	0.170	6ov2A.pdb.gz
11	PDB:5b2gC	0.292	0.346	7.432E-5	350	0.082	0.100	5b2gC.pdb.gz
12	PDB:7d3eB	0.262	0.375	3.028E-4	272	0.064	0.099	7d3eB.pdb.gz	Structures of human dual oxidase 1 complex in low-calcium and high-calcium states.
13	AFDB:F1M8L9	0.089	0.035	1.544E-1	1253	0.125	0.042	F1M8L9.pdb.gz	F1M8L9_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=1 SV=4
14	AFDB:P87243	0.071	0.043	1.816E-1	828	0.122	0.063	P87243.pdb.gz	RIX1_SCHPO Pre-rRNA-processing protein rix1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rix1 PE=1 SV=1
15	AFDB:Q9U370	0.101	0.048	2.379E-1	1076	0.132	0.052	Q9U370.pdb.gz	Q9U370_CAEEL BRCT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pis-1 PE=1 SV=1
16	AFDB:H0YPR8	0.124	0.115	2.511E-1	473	0.104	0.093	H0YPR8.pdb.gz	H0YPR8_TAEGU Dopamine receptor D2 OS=Taeniopygia guttata OX=59729 GN=DRD2 PE=3 SV=2
17	AFDB:P43322	0.097	0.067	2.511E-1	662	0.144	0.092	P43322.pdb.gz	NRG1_RAT Pro-neuregulin-1, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg1 PE=1 SV=1
18	AFDB:A0JMB7	0.081	0.043	2.953E-1	917	0.134	0.062	A0JMB7.pdb.gz	A0JMB7_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=zgc:152772 PE=2 SV=1
19	AFDB:O14647	0.091	0.032	3.472E-1	1828	0.096	0.022	O14647.pdb.gz	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
20	AFDB:Q8WMU5	0.088	0.058	3.472E-1	712	0.111	0.066	Q8WMU5.pdb.gz	FZD6_CANLF Frizzled-6 OS=Canis lupus familiaris OX=9615 GN=FZD6 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VHW2	0.0	608	423	0.896	0.901	CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit OS=Mus musculus OX=10090 GN=Cacng8 PE=1 SV=1
2	Q8VHW5	0.0	615	421	0.906	0.914	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1
3	Q8WXS5	0.0	843	425	1.000	1.000	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
4	Q9JJV4	1.31e-110	330	327	0.466	0.606	CCG4_MOUSE Voltage-dependent calcium channel gamma-4 subunit OS=Mus musculus OX=10090 GN=Cacng4 PE=1 SV=1
5	Q8VHW9	7.40e-110	328	327	0.459	0.596	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
6	Q9UBN1	1.57e-109	327	327	0.456	0.593	CCG4_HUMAN Voltage-dependent calcium channel gamma-4 subunit OS=Homo sapiens OX=9606 GN=CACNG4 PE=1 SV=1
7	O88602	1.96e-108	324	323	0.424	0.557	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
8	Q71RJ2	1.96e-108	324	323	0.424	0.557	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
9	Q9Y698	2.44e-108	324	323	0.424	0.557	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
10	Q6PFS3	1.04e-105	317	324	0.456	0.599	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
11	O60359	2.00e-104	314	315	0.424	0.571	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
12	Q8VHX0	4.82e-104	313	315	0.424	0.571	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
13	Q9JJV5	4.82e-104	313	315	0.424	0.571	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
14	Q9UF02	1.14e-30	121	275	0.160	0.247	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
15	Q8VHW8	1.76e-30	120	275	0.162	0.251	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
16	P62955	1.27e-25	107	275	0.165	0.255	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
17	P62956	1.27e-25	107	275	0.165	0.255	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
18	P62957	1.27e-25	107	275	0.165	0.255	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
19	Q9VRE6	2.00e-11	67.8	447	0.160	0.152	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
20	G5EDT2	1.09e-08	58.9	366	0.141	0.164	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13520 AA_permease_2	20	15.6	Amino acid permease
2	PF13903 Claudin_2	1.1e-15	69.4	PMP-22/EMP/MP20/Claudin tight junction
3	PF10027 DUF2269	2.9	19.4	Predicted integral membrane protein (DUF2269)
4	PF06168 DUF981	1.9e+02	13.4	Protein of unknown function (DUF981)
5	PF00822 PMP22_Claudin	3.4e-35	132.8	PMP-22/EMP/MP20/Claudin family
6	PF15009 TMEM173	1.5e+02	12.9	Transmembrane protein 173

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270458

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428994	0.991	Glutamate receptor 1
2	9606.ENSP00000296526	0.963	Glutamate receptor 2
3	9606.ENSP00000288139	0.960	Voltage-dependent L-type calcium channel subunit alpha-1D
4	9606.ENSP00000282499	0.957	Glutamate receptor 4
5	9606.ENSP00000349320	0.956	Voltage-dependent calcium channel subunit alpha-2/delta-1
6	9606.ENSP00000481554	0.952	Glutamate receptor 3
7	9606.ENSP00000438949	0.948	Voltage-dependent L-type calcium channel subunit beta-4
8	9606.ENSP00000375647	0.932	Voltage-dependent calcium channel gamma-7 subunit
9	9606.ENSP00000226021	0.931	Voltage-dependent calcium channel gamma-1 subunit
10	9606.ENSP00000301050	0.931	Voltage-dependent L-type calcium channel subunit beta-3
11	9606.ENSP00000365441	0.929	Voltage-dependent L-type calcium channel subunit alpha-1F
12	9606.ENSP00000266376	0.925	Voltage-dependent L-type calcium channel subunit alpha-1C
13	9606.ENSP00000355192	0.921	Voltage-dependent L-type calcium channel subunit alpha-1S
14	9606.ENSP00000319060	0.917	Calcium/calmodulin-dependent protein kinase type II subunit gamma
15	9606.ENSP00000345731	0.917	Disks large homolog 1
16	9606.ENSP00000381412	0.917	Calcium/calmodulin-dependent protein kinase type II subunit alpha
17	9606.ENSP00000379098	0.916	Calcium/calmodulin-dependent protein kinase type II subunit beta
18	9606.ENSP00000005284	0.915	Voltage-dependent calcium channel gamma-3 subunit
19	9606.ENSP00000339740	0.915	Calcium/calmodulin-dependent protein kinase type II subunit delta
20	9606.ENSP00000372169	0.915	Voltage-dependent calcium channel subunit alpha-2/delta-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019903	1.000	protein phosphatase binding
GO:0035255	0.999	ionotropic glutamate receptor binding
GO:0098772	0.998	molecular function regulator activity
GO:0099106	0.983	ion channel regulator activity
GO:0005246	0.972	calcium channel regulator activity
GO:0022857	0.721	transmembrane transporter activity
GO:0015075	0.554	monoatomic ion transmembrane transporter activity
GO:0015267	0.545	channel activity
GO:0005216	0.544	monoatomic ion channel activity
GO:0022836	0.537	gated channel activity
GO:0022839	0.530	monoatomic ion gated channel activity
GO:0015318	0.508	inorganic molecular entity transmembrane transporter activity
GO:0022890	0.502	inorganic cation transmembrane transporter activity
GO:0005261	0.401	monoatomic cation channel activity
GO:1901702	0.349	salt transmembrane transporter activity
GO:0046873	0.337	metal ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0022898	0.989	regulation of transmembrane transporter activity
GO:0099601	0.988	regulation of neurotransmitter receptor activity
GO:0032412	0.966	regulation of monoatomic ion transmembrane transporter activity
GO:0009987	0.467	cellular process
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098797	0.996	plasma membrane protein complex
GO:0034702	0.996	ion channel complex
GO:0043227	0.995	membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0030054	0.971	cell junction
GO:0034703	0.966	cation channel complex
GO:0098978	0.963	glutamatergic synapse
GO:0031982	0.962	vesicle
GO:0045211	0.948	postsynaptic membrane
GO:0034704	0.947	calcium channel complex
GO:0099572	0.945	postsynaptic specialization
GO:0099634	0.938	postsynaptic specialization membrane
GO:0014069	0.936	postsynaptic density
GO:0098839	0.928	postsynaptic density membrane
GO:0031090	0.921	organelle membrane
GO:0031410	0.915	cytoplasmic vesicle
GO:0005891	0.879	voltage-gated calcium channel complex
GO:0030139	0.760	endocytic vesicle
GO:0098588	0.739	bounding membrane of organelle
GO:0012506	0.717	vesicle membrane
GO:0030659	0.706	cytoplasmic vesicle membrane
GO:0030666	0.695	endocytic vesicle membrane
GO:0098878	0.677	neurotransmitter receptor complex
GO:0012505	0.596	endomembrane system
GO:0042995	0.519	cell projection
GO:0008328	0.481	ionotropic glutamate receptor complex
GO:0043005	0.461	neuron projection
GO:0036477	0.450	somatodendritic compartment
GO:0032281	0.419	AMPA glutamate receptor complex
GO:0098793	0.387	presynapse
GO:0031252	0.368	cell leading edge
GO:0030315	0.315	T-tubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]