StarFunc result for job id Q8WXS8

User Input

>input (1223 residues)
MAPLRALLSYLLPLHCALCAAAGSRTPELHLSGKLSDYGVTVPCSTDFRGRFLSHVVSGP
AAASAGSMVVDTPPTLPRHSSHLRVARSPLHPGGTLWPGRVGRHSLYFNVTVFGKELHLR
LRPNRRLVVPGSSVEWQEDFRELFRQPLRQECVYTGGVTGMPGAAVAISNCDGLAGLIRT
DSTDFFIEPLERGQQEKEASGRTHVVYRREAVQQEWAEPDGDLHNEAFGLGDLPNLLGLV
GDQLGDTERKRRHAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESL
GVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLT
RQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETS
LGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDE
QCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHC
IWKSPEQTYGQDGGWSSWTKFGSCSRSCGGGVRSRSRSCNNPSPAYGGRLCLGPMFEYQV
CNSEECPGTYEDFRAQQCAKRNSYYVHQNAKHSWVPYEPDDDAQKCELICQSADTGDVVF
MNQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVKGTL
GKASKQAGALKLVQIPAGARHIQIEALEKSPHRIVVKNQVTGSFILNPKGKEATSRTFTA
MGLEWEDAVEDAKESLKTSGPLPEAIAILALPPTEGGPRSSLAYKYVIHEDLLPLIGSNN
VLLEEMDTYEWALKSWAPCSKACGGGIQFTKYGCRRRRDHHMVQRHLCDHKKRPKPIRRR
CNQHPCSQPVWVTEEWGACSRSCGKLGVQTRGIQCLLPLSNGTHKVMPAKACAGDRPEAR
RPCLRVPCPAQWRLGAWSQCSATCGEGIQQRQVVCRTNANSLGHCEGDRPDTVQVCSLPA
CGGNHQNSTVRADVWELGTPEGQWVPQSEPLHPINKISSTEPCTGDRSVFCQMEVLDRYC
SIPGYHRLCCVSCIKKASGPNPGPDPGPTSLPPFSTPGSPLPGPQDPADAAEPPGKPTGS
EDHQHGRATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTPVPE
DKGQPGEDLRHPGTSLPAASPVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WXS8	0.999	0.999	0.000	1223	1.000	1.000	Q8WXS8.pdb.gz	ATS14_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 14 OS=Homo sapiens OX=9606 GN=ADAMTS14 PE=2 SV=2
2	AFDB:P58397	0.243	0.196	3.246E-84	1594	0.269	0.206	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
3	AFDB:Q8SXB0	0.219	0.167	1.141E-71	1688	0.228	0.165	Q8SXB0.pdb.gz	Q8SXB0_DROME ADAM metallopeptidase with thrombospondin type 1 motif A, isoform B OS=Drosophila melanogaster OX=7227 GN=AdamTS-A PE=2 SV=1
4	AFDB:Q8N6G6	0.169	0.124	8.123E-37	1762	0.124	0.086	Q8N6G6.pdb.gz	ATL1_HUMAN ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4
5	AFDB:Q86TH1	0.188	0.235	7.275E-35	951	0.138	0.178	Q86TH1.pdb.gz	ATL2_HUMAN ADAMTS-like protein 2 OS=Homo sapiens OX=9606 GN=ADAMTSL2 PE=1 SV=1
6	PDB:4q1lA	0.147	0.818	2.389E-12	202	0.044	0.267	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
7	PDB:1w0rA	0.054	0.110	5.429E-8	442	0.075	0.208	1w0rA.pdb.gz
8	PDB:4e0sB	0.048	0.063	4.355E-4	898	0.029	0.039	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
9	PDB:7nycC	0.045	0.064	4.355E-4	809	0.056	0.084	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
10	PDB:7nydE	0.057	0.127	4.600E-4	484	0.056	0.140	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
11	AFDB:L7VG99	0.054	0.059	6.113E-4	1073	0.074	0.085	L7VG99.pdb.gz	T132E_DANRE Transmembrane protein 132E OS=Danio rerio OX=7955 GN=tmem132e PE=2 SV=1
12	PDB:7ufgA	0.128	0.134	1.168E-3	1151	0.097	0.103	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:1l9mB	0.036	0.053	1.536E-3	681	0.045	0.081	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
14	PDB:3t5oA	0.046	0.063	1.714E-3	871	0.024	0.033	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
15	PDB:4a5wB	0.046	0.058	2.516E-3	871	0.018	0.025	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
16	AFDB:Q0KI85	0.055	0.060	2.837E-3	1087	0.065	0.073	Q0KI85.pdb.gz	Q0KI85_DROME Sidestep VI, isoform B OS=Drosophila melanogaster OX=7227 GN=side-VI PE=1 SV=1
17	AFDB:P43146	0.041	0.036	3.732E-3	1447	0.070	0.059	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
18	AFDB:Q1L8D0	0.048	0.051	1.732E-2	1125	0.071	0.077	Q1L8D0.pdb.gz	Q1L8D0_DANRE Cell adhesion molecule-related/down-regulated by oncogenes OS=Danio rerio OX=7955 GN=zgc:158240 PE=2 SV=2
19	PDB:2n6fA	0.034	0.150	2.381E-2	136	0.016	0.140	2n6fA.pdb.gz
20	AFDB:P32927	0.050	0.063	4.907E-2	897	0.061	0.084	P32927.pdb.gz	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RXR8	0.0	2035	1206	0.814	0.826	B2RXR8_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=2 SV=1
2	B2RXX5	0.0	2039	1206	0.817	0.828	B2RXX5_MOUSE A Disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=1 SV=1
3	B2RY45	0.0	1315	1204	0.544	0.552	B2RY45_MOUSE Adamts3 protein OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
4	B2RY57	0.0	1333	1203	0.550	0.559	B2RY57_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
5	E9PX39	0.0	2033	1209	0.817	0.826	E9PX39_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 14 OS=Mus musculus OX=10090 GN=Adamts14 PE=1 SV=1
6	E9Q287	0.0	1316	1204	0.544	0.552	E9Q287_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
7	G3X9D2	0.0	1333	1203	0.550	0.559	G3X9D2_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
8	O15072	0.0	1349	1205	0.531	0.539	ATS3_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 3 OS=Homo sapiens OX=9606 GN=ADAMTS3 PE=1 SV=4
9	O95450	0.0	1216	1211	0.506	0.511	ATS2_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Homo sapiens OX=9606 GN=ADAMTS2 PE=2 SV=2
10	P79331	0.0	1232	1205	0.509	0.517	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1
11	Q3UV61	0.0	605	423	0.249	0.719	Q3UV61_MOUSE PLAC domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Adamts14 PE=2 SV=1
12	Q8C9W3	0.0	1226	1213	0.498	0.502	ATS2_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Mus musculus OX=10090 GN=Adamts2 PE=1 SV=2
13	Q8WXS8	0.0	2526	1223	1.000	1.000	ATS14_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 14 OS=Homo sapiens OX=9606 GN=ADAMTS14 PE=2 SV=2
14	D3Z1A5	2.65e-153	491	1117	0.286	0.313	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
15	Q9UKP5	1.13e-152	489	1117	0.283	0.310	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
16	Q8TE60	6.09e-144	469	1221	0.267	0.267	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
17	E7FEJ5	7.31e-143	466	1244	0.267	0.263	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
18	Q68SA9	1.61e-140	468	1657	0.263	0.194	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
19	Q9UKP4	3.07e-139	465	1686	0.255	0.185	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
20	Q4VC17	8.48e-136	447	1219	0.258	0.259	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	7.5e-17	72.9	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	0.0021	29.5	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	1.2e-16	72.4	ADAM-TS Spacer 1
4	PF16313 DUF4953	3e+02	12.0	Met-zincin
5	PF00413 Peptidase_M10	25	16.1	Matrixin
6	PF02031 Peptidase_M7	9.4e+02	11.3	Streptomyces extracellular neutral proteinase (M7) family
7	PF01562 Pep_M12B_propep	3.2e-35	132.9	Reprolysin family propeptide
8	PF01421 Reprolysin	1.1e-17	76.2	Reprolysin (M12B) family zinc metalloprotease
9	PF13574 Reprolysin_2	0.035	25.5	Metallo-peptidase family M12B Reprolysin-like
10	PF13582 Reprolysin_3	2.1e-06	39.7	Metallo-peptidase family M12B Reprolysin-like
11	PF13583 Reprolysin_4	0.36	22.0	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	2.3e-11	55.7	Metallo-peptidase family M12
13	PF19030 TSP1_ADAMTS	2.7e-28	109.3	Thrombospondin type 1 domain
14	PF19035 TSP1_CCN	0.0014	30.2	CCN3 Nov like TSP1 domain
15	PF19028 TSP1_spondin	8.1e-07	40.6	Spondin-like TSP1 domain
16	PF00090 TSP_1	1.6e-18	77.9	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348385	0.960	Collagen alpha-1(XXVII) chain
2	9606.ENSP00000297268	0.947	Collagen alpha-2(I) chain
3	9606.ENSP00000364000	0.947	Collagen alpha-2(V) chain
4	9606.ENSP00000359603	0.940	Collagen alpha-1(XXIV) chain
5	9606.ENSP00000360882	0.939	Collagen alpha-1(V) chain
6	9606.ENSP00000225964	0.937	Collagen alpha-1(I) chain
7	9606.ENSP00000359114	0.930	Collagen alpha-1(XI) chain
8	9606.ENSP00000264828	0.929	Collagen alpha-3(V) chain
9	9606.ENSP00000369889	0.929	Collagen alpha-1(II) chain
10	9606.ENSP00000360997	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 13
11	9606.ENSP00000260356	0.923	Thrombospondin-1
12	9606.ENSP00000304408	0.923	Collagen alpha-1(III) chain
13	9606.ENSP00000422554	0.922	A disintegrin and metalloproteinase with thrombospondin motifs 12
14	9606.ENSP00000299164	0.921	ADAM metallopeptidase with thrombospondin type 1 motif 15
15	9606.ENSP00000374071	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 20
16	9606.ENSP00000274181	0.920	ADAM metallopeptidase with thrombospondin type 1 motif 16
17	9606.ENSP00000373472	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 7
18	9606.ENSP00000418735	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 9
19	9606.ENSP00000268070	0.919	ADAM metallopeptidase with thrombospondin type 1 motif 17
20	9606.ENSP00000270328	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008237	0.997	metallopeptidase activity
GO:0004222	0.986	metalloendopeptidase activity
GO:0005488	0.881	binding
GO:0005515	0.860	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0030198	0.972	extracellular matrix organization
GO:0097435	0.726	supramolecular fiber organization
GO:0030199	0.685	collagen fibril organization
GO:0008152	0.538	metabolic process
GO:0071704	0.527	organic substance metabolic process
GO:1901564	0.455	organonitrogen compound metabolic process
GO:0044238	0.447	primary metabolic process
GO:0043170	0.437	macromolecule metabolic process
GO:0019538	0.410	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0071944	0.957	cell periphery
GO:0030312	0.880	external encapsulating structure
GO:0031012	0.874	extracellular matrix
GO:0043226	0.780	organelle
GO:0043227	0.774	membrane-bounded organelle
GO:0012505	0.487	endomembrane system
GO:0062023	0.481	collagen-containing extracellular matrix
GO:0005622	0.388	intracellular anatomical structure
GO:0043231	0.340	intracellular membrane-bounded organelle
GO:0005737	0.337	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.986	Metalloendopeptidases.

[back to server]