StarFunc result for job id Q8WXX0

User Input

>input (1400 residues)
MSSEQDKSASKEKSKKPVRFLPQLSMEKLASKEKFKAPARALPQLSMVSTKPHWQQAAPS
FHLSVKQDDESPEPFSVKNEQSHAEYMERFGKKGKLPHQVDDSYVGPSTSKSKGKSPHKE
RENFRSTLVNVIMQQDADLDSAVPDGSTIPKPTASAIEKDILRYYYYIHHGIDTDHVAPM
EDSWLEHVLDLVPQHLKVFTDSIVTLSDEMREDYLLSVRKSIVDFVLKDPREKGDDKKTD
ELPAHRAEMEILPKPWRKSFLAASSYIRDHLNAMNPTMLAVLDLWHTNFKKLRLVDIKEF
HNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNKKKQLPTGDSSAKLESF
FNCAAALMTLQLQDLTLVSMQDFTDLIAQPPDSVRAFEHPGFIMRLILDNDTIKFEPELS
DYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNEIVDAHKEKIKEVI
MKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTS
IKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALST
PPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWY
GRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLK
KAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
RAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPL
IQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYS
LEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYE
KQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDI
MRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELL
EILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQV
EKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAIP
MGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISD
DSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHL
HLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFD
EFNRIDLEVLSVVAQQILTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.389	0.128	1.685E-41	4579	0.189	0.058	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7z8gA	0.389	0.187	3.019E-33	3047	0.138	0.063	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
3	PDB:7kzmC	0.380	0.146	2.480E-26	3890	0.219	0.079	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
4	PDB:5nugA	0.258	0.128	5.412E-25	2920	0.125	0.060	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
5	PDB:7mi6A	0.338	0.198	3.541E-23	2419	0.105	0.061	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
6	PDB:4w8fB	0.329	0.180	1.689E-22	2609	0.107	0.057	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
7	AFDB:Q9VN30	0.261	0.328	2.429E-21	1079	0.112	0.146	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
8	PDB:7mi8A	0.233	0.372	1.301E-14	868	0.079	0.128	7mi8A.pdb.gz
9	AFDB:Q281W6	0.085	0.863	1.509E-9	133	0.058	0.609	Q281W6.pdb.gz	Q281W6_DROME Kl-2 protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=kl-2 PE=4 SV=1
10	AFDB:Q8JGN7	0.125	0.739	2.247E-6	202	0.035	0.243	Q8JGN7.pdb.gz
11	AFDB:P33332	0.067	0.069	2.545E-4	1336	0.074	0.077	P33332.pdb.gz	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
12	AFDB:O14207	0.056	0.046	3.883E-4	1888	0.136	0.101	O14207.pdb.gz	MMS22_SCHPO Protein mms22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mus7 PE=3 SV=1
13	AFDB:Q558Z9	0.056	0.082	1.164E-3	840	0.083	0.138	Q558Z9.pdb.gz	EXOC7_DICDI Exocyst complex component 7 OS=Dictyostelium discoideum OX=44689 GN=exoc7 PE=3 SV=1
14	AFDB:A0A0B4KEE4	0.046	0.060	1.776E-3	965	0.085	0.123	A0A0B4KEE4.pdb.gz	KOI_DROME Klaroid protein OS=Drosophila melanogaster OX=7227 GN=koi PE=2 SV=1
15	AFDB:Q8N6Y0	0.044	0.080	3.962E-3	703	0.067	0.134	Q8N6Y0.pdb.gz	USBP1_HUMAN Harmonin-binding protein USHBP1 OS=Homo sapiens OX=9606 GN=USHBP1 PE=1 SV=1
16	AFDB:O14164	0.067	0.082	7.465E-3	918	0.078	0.119	O14164.pdb.gz	EIF3C_SCHPO Eukaryotic translation initiation factor 3 subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nip1 PE=1 SV=2
17	AFDB:P36956	0.061	0.070	7.465E-3	1147	0.093	0.113	P36956.pdb.gz	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2
18	PDB:7v2yB	0.053	0.057	1.428E-1	1226	0.100	0.114	7v2yB.pdb.gz
19	PDB:5uwuC	0.060	0.071	1.621E-1	998	0.084	0.117	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
20	PDB:2b7mB	0.063	0.125	2.088E-1	523	0.045	0.120	2b7mB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6H2EJG3	0.0	1215	4065	0.440	0.152	A0A6H2EJG3_DROME Dynein heavy chain at 36C, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=1
2	E9Q8T7	0.0	729	4250	0.294	0.097	DYH1_MOUSE Dynein axonemal heavy chain 1 OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1
3	Q4AC22	0.0	793	4149	0.340	0.115	Q4AC22_CHLRE Dynein heavy chain 9 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC9 PE=1 SV=3
4	Q7KVA7	0.0	711	3964	0.299	0.106	Q7KVA7_DROME Dynein heavy chain at 62B OS=Drosophila melanogaster OX=7227 GN=Dhc62B PE=3 SV=2
5	Q8WXX0	0.0	2902	4024	1.000	0.348	DYH7_HUMAN Dynein axonemal heavy chain 7 OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2
6	Q9P2D7	0.0	726	4265	0.285	0.094	DYH1_HUMAN Dynein axonemal heavy chain 1 OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=6
7	Q9VJC6	0.0	1215	4024	0.440	0.153	Q9VJC6_DROME Dynein heavy chain at 36C, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhc36C PE=3 SV=2
8	Q9VZ77	0.0	676	4385	0.266	0.085	Q9VZ77_DROME Dynein, axonemal, heavy chain 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Dnah3 PE=3 SV=3
9	Q585U4	1.29e-180	599	4246	0.249	0.082	Q585U4_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.85 PE=4 SV=1
10	Q384K3	1.74e-172	575	4152	0.249	0.084	Q384K3_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0390 PE=4 SV=1
11	Q38B68	3.66e-157	530	4142	0.219	0.074	Q38B68_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1720 PE=4 SV=1
12	E9Q0B6	1.16e-153	519	4144	0.197	0.067	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
13	Q9P225	5.58e-141	481	4427	0.239	0.076	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
14	P0C6F1	1.07e-139	478	4456	0.184	0.058	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
15	E7FGT8	1.81e-136	468	4626	0.204	0.062	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
16	D3YYQ8	3.11e-135	464	4591	0.213	0.065	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
17	F7ABZ6	4.24e-135	464	4534	0.213	0.066	F7ABZ6_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
18	Q9VWZ3	2.22e-134	462	4081	0.174	0.060	Q9VWZ3_DROME Dynein heavy chain at 16F OS=Drosophila melanogaster OX=7227 GN=Dhc16F PE=3 SV=1
19	Q9SMH3	5.41e-132	454	4625	0.240	0.073	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
20	E9Q3H7	3.99e-130	449	4092	0.180	0.062	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	5.6e+02	12.4	ATPase family associated with various cellular activities (AAA)
2	PF13238 AAA_18	4.4e+02	12.8	AAA domain
3	PF07728 AAA_5	4.1e+02	12.4	AAA domain (dynein-related subfamily)
4	PF12774 AAA_6	1.9e-57	206.3	Hydrolytic ATP binding site of dynein motor region
5	PF08393 DHC_N2	7.9e-144	491.3	Dynein heavy chain, N-terminal region 2
6	PF03048 Herpes_UL92	3e+02	12.6	UL92 family
7	PF00910 RNA_helicase	3.4e+02	13.0	RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354791	0.873	Dynactin subunit 1
2	9606.ENSP00000480538	0.868	Dynein intermediate chain 1, axonemal
3	9606.ENSP00000408910	0.855	Dynactin subunit 2
4	9606.ENSP00000289228	0.841	Beta-centractin
5	9606.ENSP00000400252	0.841	Dynein intermediate chain 2, axonemal
6	9606.ENSP00000358921	0.828	Alpha-centractin
7	9606.ENSP00000254286	0.820	Actin related protein 10 homolog
8	9606.ENSP00000259632	0.816	Dynactin subunit 3
9	9606.ENSP00000414906	0.807	Dynactin subunit 4
10	9606.ENSP00000334002	0.804	Huntingtin-associated protein 1
11	9606.ENSP00000300087	0.801	Dynactin subunit 5
12	9606.ENSP00000221114	0.800	Dynactin subunit 6
13	9606.ENSP00000452037	0.721	Dynein light chain 1, axonemal
14	9606.ENSP00000360065	0.684	WD repeat-containing protein 78
15	9606.ENSP00000199447	0.683	Thioredoxin domain-containing protein 3
16	9606.ENSP00000294664	0.673	WD repeat-containing protein 63
17	9606.ENSP00000216068	0.670	Dynein light chain 4, axonemal
18	9606.ENSP00000318429	0.668	Coiled-coil domain-containing protein 114
19	9606.ENSP00000374490	0.643	Dynein heavy chain 17, axonemal
20	9606.ENSP00000401514	0.626	Dynein heavy chain 1, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003777	0.999	microtubule motor activity
GO:0005488	0.986	binding
GO:0005515	0.974	protein binding
GO:0003824	0.316	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0001578	0.899	microtubule bundle formation
GO:0035082	0.862	axoneme assembly
GO:0070286	0.837	axonemal dynein complex assembly
GO:0003341	0.677	cilium movement

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.999	cilium
GO:0005737	0.996	cytoplasm
GO:0005856	0.996	cytoskeleton
GO:0005875	0.991	microtubule associated complex
GO:0030286	0.965	dynein complex
GO:0099568	0.955	cytoplasmic region
GO:0032838	0.857	plasma membrane bounded cell projection cytoplasm
GO:0005829	0.842	cytosol
GO:0005930	0.823	axoneme
GO:0005858	0.715	axonemal dynein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]