StarFunc result for job id Q8WXX5

User Input

>input (260 residues)
MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQ
ILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTY
KGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVK
ESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEA
KYCKSSKGGGKKSALKKEKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZN2	0.859	0.859	1.130E-35	260	1.000	1.000	A0A024QZN2.pdb.gz
2	AFDB:Q9UTQ5	0.693	0.645	6.732E-16	282	0.373	0.344	Q9UTQ5.pdb.gz	YL39_SCHPO Uncharacterized J domain-containing protein C1071.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1071.09c PE=3 SV=1
3	AFDB:Q5A1E4	0.597	0.574	9.910E-11	274	0.269	0.255	Q5A1E4.pdb.gz	Q5A1E4_CANAL J domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCJ1 PE=4 SV=1
4	AFDB:Q389Z2	0.380	0.378	8.698E-9	262	0.227	0.225	Q389Z2.pdb.gz	Q389Z2_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0460 PE=4 SV=1
5	AFDB:Q96KC8	0.263	0.129	1.322E-5	554	0.208	0.097	Q96KC8.pdb.gz	DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens OX=9606 GN=DNAJC1 PE=1 SV=1
6	AFDB:Q9C911	0.241	0.102	1.533E-5	630	0.223	0.092	Q9C911.pdb.gz	JJJ1_ARATH DNAJ protein JJJ1 homolog OS=Arabidopsis thaliana OX=3702 GN=JJJ1 PE=1 SV=1
7	AFDB:Q9Y7T9	0.257	0.320	1.691E-5	208	0.154	0.192	Q9Y7T9.pdb.gz	YCJD_SCHPO Uncharacterized J domain-containing protein C63.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC63.13 PE=3 SV=1
8	AFDB:Q61712	0.263	0.129	1.866E-5	552	0.208	0.098	Q61712.pdb.gz	DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus OX=10090 GN=Dnajc1 PE=1 SV=1
9	AFDB:Q5F1R6	0.241	0.121	2.904E-5	531	0.242	0.119	Q5F1R6.pdb.gz	DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=2
10	AFDB:Q8I489	0.287	0.193	4.098E-5	402	0.112	0.072	Q8I489.pdb.gz	Q8I489_PLAF7 Heat shock protein 40, type II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0501100.1 PE=4 SV=2
11	PDB:6byrA	0.230	0.151	5.149E-3	405	0.112	0.072	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.241	0.239	7.264E-3	262	0.150	0.149	7x3kA.pdb.gz
13	PDB:1fpoA	0.242	0.356	4.481E-2	171	0.108	0.164	1fpoA.pdb.gz
14	PDB:2y4uA	0.208	0.130	1.198E-1	424	0.088	0.054	2y4uA.pdb.gz
15	PDB:2l6lA	0.197	0.308	2.161E-1	155	0.073	0.123	2l6lA.pdb.gz	Structure and mechanistic insights into novel iron-mediated moonlighting functions of human J-protein cochaperone, Dph4.
16	PDB:5y88T	0.196	0.429	2.385E-1	107	0.088	0.215	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
17	PDB:3uo3A	0.179	0.249	6.376E-1	174	0.115	0.172	3uo3A.pdb.gz
18	PDB:3axjA	0.126	0.136	1.471	225	0.077	0.089	3axjA.pdb.gz
19	PDB:6fx0A	0.162	0.176	1.471	238	0.065	0.071	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
20	PDB:6kxwA	0.131	0.134	1.791	252	0.108	0.111	6kxwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WXX5	0.0	528	260	1.000	1.000	DNJC9_HUMAN DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1
2	Q9UTQ5	4.95e-32	120	282	0.331	0.305	YL39_SCHPO Uncharacterized J domain-containing protein C1071.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1071.09c PE=3 SV=1
3	Q5A1E4	2.70e-21	92.0	274	0.265	0.252	Q5A1E4_CANAL J domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCJ1 PE=4 SV=1
4	Q389Z2	2.01e-14	73.2	262	0.265	0.263	Q389Z2_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0460 PE=4 SV=1
5	Q57WJ9	1.48e-12	68.9	481	0.131	0.071	Q57WJ9_TRYB2 Chaperone protein DnaJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28A12.330 PE=4 SV=1
6	Q7Z6W7	1.84e-12	68.2	309	0.123	0.104	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
7	Q99KV1	5.86e-12	67.0	358	0.138	0.101	DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus OX=10090 GN=Dnajb11 PE=1 SV=1
8	Q6TUG0	6.26e-12	67.0	358	0.138	0.101	DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus OX=10116 GN=Dnajb11 PE=2 SV=1
9	Q9UBS4	6.56e-12	67.0	358	0.138	0.101	DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1
10	O76224	1.49e-11	65.5	336	0.108	0.083	O76224_9TRYP Chaperone OS=Trypanosoma brucei OX=5691 GN=DNAJ PE=4 SV=1
11	Q38AB7	1.49e-11	65.5	336	0.108	0.083	Q38AB7_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2000 PE=4 SV=1
12	Q80ZP0	1.68e-11	64.3	234	0.112	0.124	Q80ZP0_MOUSE 4930503B20Rik protein OS=Mus musculus OX=10090 GN=4930503B20Rik PE=2 SV=1
13	G5E8V6	2.05e-11	64.3	231	0.112	0.126	G5E8V6_MOUSE RIKEN cDNA 4930503B20 gene OS=Mus musculus OX=10090 GN=4930503B20Rik PE=4 SV=1
14	Q9VPQ2	2.54e-11	65.1	354	0.119	0.088	DJSHV_DROME DnaJ homolog shv OS=Drosophila melanogaster OX=7227 GN=shv PE=1 SV=1
15	F4HWD5	3.01e-11	65.1	400	0.196	0.128	F4HWD5_ARATH DNAJ heat shock N-terminal domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g21080 PE=1 SV=1
16	Q9Y7T9	5.63e-11	62.4	208	0.108	0.135	YCJD_SCHPO Uncharacterized J domain-containing protein C63.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC63.13 PE=3 SV=1
17	Q9T024	7.51e-11	63.5	345	0.150	0.113	Q9T024_ARATH AT4g39150/T22F8_50 OS=Arabidopsis thaliana OX=3702 GN=At4g39150 PE=1 SV=1
18	Q6DHR2	7.88e-11	63.5	316	0.115	0.095	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
19	Q380Y9	1.02e-10	63.2	308	0.119	0.101	Q380Y9_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8750 PE=4 SV=1
20	E9PH18	2.03e-10	61.2	211	0.112	0.137	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	8.9e-15	65.9	DnaJ domain
2	PF09787 Golgin_A5	3.2e+02	12.2	Golgin subfamily A member 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362041

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242505	0.954	Protein FAM149B1
2	9606.ENSP00000255120	0.932	Nuclear autoantigenic sperm protein
3	9606.ENSP00000376272	0.882	Replication factor C subunit 4
4	9606.ENSP00000370376	0.873	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
5	9606.ENSP00000265056	0.855	DNA replication licensing factor MCM2
6	9606.ENSP00000339145	0.814	Ribosomal RNA processing protein 1 homolog B
7	9606.ENSP00000264156	0.789	DNA replication licensing factor MCM6
8	9606.ENSP00000265465	0.783	DNA polymerase alpha subunit B
9	9606.ENSP00000233146	0.782	DNA mismatch repair protein Msh2
10	9606.ENSP00000286398	0.781	Structural maintenance of chromosomes protein 2
11	9606.ENSP00000305480	0.780	Flap endonuclease 1
12	9606.ENSP00000300738	0.770	Ribonucleoside-diphosphate reductase large subunit
13	9606.ENSP00000352252	0.766	Histone cluster 1 H3 family member j
14	9606.ENSP00000307288	0.757	DNA replication licensing factor MCM7
15	9606.ENSP00000368458	0.756	Proliferating cell nuclear antigen
16	9606.ENSP00000350491	0.742	DNA primase small subunit
17	9606.ENSP00000216122	0.713	DNA replication licensing factor MCM5
18	9606.ENSP00000244537	0.711	Histone cluster 1 H4 family member f
19	9606.ENSP00000264108	0.707	Histone acetyltransferase type B catalytic subunit
20	9606.ENSP00000263697	0.692	DnaJ homolog subfamily C member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042393	0.994	histone binding
GO:0031072	0.991	heat shock protein binding
GO:0051087	0.976	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0016043	0.991	cellular component organization
GO:0071824	0.970	protein-DNA complex subunit organization
GO:0034728	0.958	nucleosome organization
GO:0065009	0.955	regulation of molecular function
GO:0065004	0.916	protein-DNA complex assembly
GO:0006334	0.910	nucleosome assembly
GO:0043462	0.883	regulation of ATP-dependent activity
GO:0044093	0.852	positive regulation of molecular function
GO:0032781	0.758	positive regulation of ATP-dependent activity
GO:0050789	0.747	regulation of biological process
GO:0050794	0.596	regulation of cellular process
GO:0019222	0.325	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.974	protein-containing complex
GO:0071944	0.924	cell periphery
GO:0005886	0.896	plasma membrane
GO:0043232	0.871	intracellular non-membrane-bounded organelle
GO:0005576	0.490	extracellular region
GO:0005615	0.429	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]