StarFunc result for job id Q8WXX7

User Input

>input (1259 residues)
MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNG
KPPSSAPSRPRPPRRKRRESTSAEEDIIDGFAMTSFVTFEALEKDVALKPQERVEKRQTP
LTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQN
SCRDSDSESASGESKGFHRSSSRERLSDSSAPSSLGTGYFCDSDSDQEEKASDASSEKLF
NTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDPCP
QVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQR
PPRPQSPTQLLHQNLPPVQAHPSAQSLSQPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPP
HISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQVA
GHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQ
HTFTPFPHAIPPTAIMPTPAPPMFDKYPTKVDPFYRHSLFHSYPPAVSGIPPMIPPTGPF
GSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAWQI
YHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHP
TGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDG
PSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKD
DKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSES
RKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESARPNSTSSR
EAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLA
SMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYR
ELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHHHPLSVDPR
REHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHYPRISPT
AGNQNGLLNKTPPTAALSAPPPLISTLGGRPVSPRRTTPLSAEIRERPPSHTLKDIEAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WPF7	0.061	0.061	0.000	1261	0.932	0.930	A0A087WPF7.pdb.gz	AUTS2_MOUSE Autism susceptibility gene 2 protein homolog OS=Mus musculus OX=10090 GN=Auts2 PE=1 SV=2
2	AFDB:E7F4D0	0.074	0.073	2.968E-86	1278	0.624	0.614	E7F4D0.pdb.gz	E7F4D0_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=3
3	AFDB:Q9HCM7	0.052	0.059	2.567E-33	1045	0.361	0.434	Q9HCM7.pdb.gz	FBSL_HUMAN Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4
4	AFDB:Q499E5	0.037	0.045	1.751E-2	926	0.129	0.175	Q499E5.pdb.gz	STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus OX=10090 GN=Stox2 PE=2 SV=2
5	AFDB:Q3URK3	0.039	0.029	1.184E-1	2007	0.147	0.092	Q3URK3.pdb.gz	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
6	AFDB:Q9H7N4	0.046	0.045	1.686E-1	1312	0.171	0.164	Q9H7N4.pdb.gz	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
7	AFDB:Q8SXD4	0.033	0.036	1.810E-1	1122	0.133	0.149	Q8SXD4.pdb.gz	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1
8	AFDB:F4JCS8	0.040	0.034	1.943E-1	1613	0.157	0.123	F4JCS8.pdb.gz	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1
9	AFDB:Q63625	0.036	0.030	2.238E-1	1685	0.161	0.120	Q63625.pdb.gz	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
10	AFDB:Q6A065	0.032	0.027	2.971E-1	1588	0.145	0.115	Q6A065.pdb.gz	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WPF7	0.0	1972	1261	0.930	0.929	AUTS2_MOUSE Autism susceptibility gene 2 protein homolog OS=Mus musculus OX=10090 GN=Auts2 PE=1 SV=2
2	A0A1X9RK86	0.0	1176	1277	0.635	0.626	A0A1X9RK86_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=1
3	A0A1X9RK87	0.0	1176	1277	0.635	0.626	A0A1X9RK87_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=1
4	A0A1X9RK91	0.0	926	811	0.454	0.704	A0A1X9RK91_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=1
5	A0A2R8RIS2	0.0	942	810	0.454	0.705	A0A2R8RIS2_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=4 SV=1
6	E7F4D0	0.0	1182	1278	0.635	0.626	E7F4D0_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=3
7	F1QRM5	0.0	1085	1126	0.567	0.634	F1QRM5_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=4 SV=3
8	Q8WXX7	0.0	2521	1259	1.000	1.000	AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens OX=9606 GN=AUTS2 PE=1 SV=1
9	Q9HCM7	8.81e-77	278	1045	0.241	0.290	FBSL_HUMAN Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4
10	Q8R089	4.44e-61	219	466	0.104	0.281	FBRS_MOUSE Probable fibrosin-1 OS=Mus musculus OX=10090 GN=Fbrs PE=1 SV=2
11	Q9VXM5	7.35e-07	56.6	2486	0.048	0.025	Q9VXM5_DROME LD22609p OS=Drosophila melanogaster OX=7227 GN=tay PE=2 SV=3
12	X2JC54	7.67e-07	56.6	2485	0.048	0.025	X2JC54_DROME Tay bridge, isoform D OS=Drosophila melanogaster OX=7227 GN=tay PE=4 SV=1
13	O96046	1.1	35.8	559	0.025	0.055	O96046_DROME Cortactin OS=Drosophila melanogaster OX=7227 GN=Cortactin PE=2 SV=1
14	Q9XZ34	5.4	33.9	1416	0.032	0.028	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
15	F1M0L3	6.2	33.9	3986	0.030	0.010	F1M0L3_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2a PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15336 Auts2	4.3e-98	339.3	Autism susceptibility gene 2 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000445704	0.991	Polycomb group RING finger protein 5
2	9606.ENSP00000419494	0.976	RING1 and YY1-binding protein
3	9606.ENSP00000328004	0.963	YY1 associated factor 2, isoform CRA_d
4	9606.ENSP00000356480	0.924	E3 ubiquitin-protein ligase RING2
5	9606.ENSP00000262506	0.902	Casein kinase II subunit alpha
6	9606.ENSP00000354724	0.890	Polycomb group RING finger protein 3
7	9606.ENSP00000263253	0.844	Histone acetyltransferase p300
8	9606.ENSP00000358862	0.838	Polycomb group RING finger protein 6
9	9606.ENSP00000483236	0.836	DDB1- and CUL4-associated factor 7
10	9606.ENSP00000398481	0.829	Calcium-dependent secretion activator 2
11	9606.ENSP00000363787	0.819	E3 ubiquitin-protein ligase RING1
12	9606.ENSP00000361214	0.770	Pro-neuregulin-3, membrane-bound isoform
13	9606.ENSP00000318094	0.764	Polycomb protein SCMH1
14	9606.ENSP00000217244	0.750	Casein kinase II subunit alpha
15	9606.ENSP00000365042	0.735	Casein kinase II subunit beta
16	9606.ENSP00000381932	0.731	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
17	9606.ENSP00000308750	0.685	Chromobox protein homolog 2
18	9606.ENSP00000341684	0.684	Coiled-coil domain containing 15
19	9606.ENSP00000348460	0.679	Neuronal PAS domain-containing protein 3
20	9606.ENSP00000354778	0.666	Contactin-associated protein-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.966	biological regulation
GO:0009987	0.966	cellular process
GO:0050794	0.957	regulation of cellular process
GO:0032501	0.882	multicellular organismal process
GO:0048856	0.875	anatomical structure development
GO:0007275	0.786	multicellular organism development
GO:0048518	0.758	positive regulation of biological process
GO:0048522	0.718	positive regulation of cellular process
GO:0007399	0.666	nervous system development
GO:0019222	0.520	regulation of metabolic process
GO:0080090	0.498	regulation of primary metabolic process
GO:0060255	0.498	regulation of macromolecule metabolic process
GO:0051171	0.498	regulation of nitrogen compound metabolic process
GO:0031323	0.498	regulation of cellular metabolic process
GO:0010468	0.470	regulation of gene expression
GO:0051252	0.464	regulation of RNA metabolic process
GO:0010556	0.461	regulation of macromolecule biosynthetic process
GO:0031326	0.461	regulation of cellular biosynthetic process
GO:0006355	0.426	regulation of DNA-templated transcription
GO:0030154	0.337	cell differentiation
GO:0071840	0.325	cellular component organization or biogenesis
GO:0009653	0.325	anatomical structure morphogenesis
GO:0048468	0.321	cell development
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.956	intracellular organelle lumen
GO:0031981	0.922	nuclear lumen
GO:0005654	0.826	nucleoplasm
GO:0120025	0.819	plasma membrane bounded cell projection
GO:0005856	0.807	cytoskeleton
GO:0030427	0.791	site of polarized growth
GO:0015629	0.776	actin cytoskeleton
GO:0030426	0.773	growth cone
GO:0005737	0.463	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]