StarFunc result for job id Q8WY41

User Input

>input (292 residues)
MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGE
PRFGCARGGNGGGGSPPSSSSSSCCSPHTGAGPGALGPALGPPDYDEDDDDDSDEPGSRG
RYLGSALELRALELCAGPAEAGLLEERFAELSPFAGRAAAVLLGCAPAAAAAATTTSEAT
PREERAPAWAAEPRLHAASGAAAARLLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVL
CPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPRSARDGPPGKKLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WY41	1.000	1.000	3.126E-49	292	1.000	1.000	Q8WY41.pdb.gz	NANO1_HUMAN Nanos homolog 1 OS=Homo sapiens OX=9606 GN=NANOS1 PE=1 SV=2
2	AFDB:O62486	0.170	0.061	1.737E-2	871	0.151	0.051	O62486.pdb.gz	O62486_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-3 PE=1 SV=1
3	AFDB:Q14159	0.076	0.029	1.347	915	0.154	0.049	Q14159.pdb.gz	SPIDR_HUMAN DNA repair-scaffolding protein OS=Homo sapiens OX=9606 GN=SPIDR PE=1 SV=2
4	AFDB:A9RNY0	0.084	0.068	1.553	390	0.113	0.085	A9RNY0.pdb.gz	SOK4_PHYPA Protein SOSEKI 4 OS=Physcomitrium patens OX=3218 GN=SOK4 PE=1 SV=1
5	AFDB:P24394	0.117	0.046	2.748	825	0.154	0.055	P24394.pdb.gz	IL4RA_HUMAN Interleukin-4 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL4R PE=1 SV=1
6	AFDB:O14246	0.085	0.058	2.952	508	0.075	0.043	O14246.pdb.gz	TPZ1_SCHPO Protection of telomeres protein tpz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpz1 PE=1 SV=2
7	AFDB:Q17381	0.078	0.052	2.952	506	0.110	0.063	Q17381.pdb.gz	PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans OX=6239 GN=pha-4 PE=1 SV=1
8	AFDB:Q2VWA4	0.077	0.031	2.952	1001	0.219	0.064	Q2VWA4.pdb.gz	SKOR2_HUMAN SKI family transcriptional corepressor 2 OS=Homo sapiens OX=9606 GN=SKOR2 PE=1 SV=3
9	AFDB:O49067	0.074	0.046	3.170	531	0.134	0.073	O49067.pdb.gz	LG2_MAIZE Transcription factor LG2 OS=Zea mays OX=4577 GN=LG2 PE=2 SV=1
10	AFDB:Q12398	0.087	0.063	3.170	434	0.099	0.067	Q12398.pdb.gz	HMS1_YEAST Probable transcription factor HMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMS1 PE=1 SV=1
11	PDB:3j6bM	0.060	0.100	7.935	151	0.024	0.046	3j6bM.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WY41	0.0	572	292	1.000	1.000	NANO1_HUMAN Nanos homolog 1 OS=Homo sapiens OX=9606 GN=NANOS1 PE=1 SV=2
2	Q80WY3	1.35e-126	363	267	0.771	0.843	NANO1_MOUSE Nanos homolog 1 OS=Mus musculus OX=10090 GN=Nanos1 PE=2 SV=2
3	E7FDB3	2.79e-30	115	228	0.318	0.408	NANO1_DANRE Nanos homolog 1 OS=Danio rerio OX=7955 GN=nanos1 PE=3 SV=1
4	Q07937	8.62e-23	93.2	128	0.137	0.312	NANO1_XENLA Nanos homolog 1 OS=Xenopus laevis OX=8355 GN=nanos1 PE=1 SV=1
5	A5Y5A4	1.05e-21	92.8	214	0.130	0.178	A5Y5A4_SCHMD Nanos-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1
6	P60322	9.86e-21	87.8	136	0.116	0.250	NANO2_MOUSE Nanos homolog 2 OS=Mus musculus OX=10090 GN=Nanos2 PE=1 SV=2
7	P60321	4.65e-20	86.3	138	0.113	0.239	NANO2_HUMAN Nanos homolog 2 OS=Homo sapiens OX=9606 GN=NANOS2 PE=1 SV=1
8	Q90WW1	3.74e-18	81.6	159	0.110	0.201	NANO3_DANRE Nanos homolog 3 OS=Danio rerio OX=7955 GN=nanos3 PE=1 SV=1
9	P60324	2.80e-17	79.7	178	0.103	0.169	NANO3_MOUSE Nanos homolog 3 OS=Mus musculus OX=10090 GN=Nanos3 PE=1 SV=1
10	P60323	8.46e-17	78.6	173	0.103	0.173	NANO3_HUMAN Nanos homolog 3 OS=Homo sapiens OX=9606 GN=NANOS3 PE=1 SV=1
11	P25724	1.95e-16	80.9	401	0.113	0.082	NANOS_DROME Protein nanos OS=Drosophila melanogaster OX=7227 GN=nanos PE=1 SV=1
12	A7XBY3	1.17e-15	75.9	201	0.106	0.154	A7XBY3_ORYLA NANOS3 OS=Oryzias latipes OX=8090 GN=nanos3 PE=2 SV=1
13	Q09597	9.87e-05	45.4	311	0.062	0.058	Q09597_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-1 PE=3 SV=1
14	Q8GSM2	1.1	33.5	896	0.096	0.031	LOX23_HORVU Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare OX=4513 GN=LOX2.3 PE=1 SV=1
15	O18218	1.5	33.1	867	0.055	0.018	O18218_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-3 PE=1 SV=2
16	O62486	1.6	32.7	871	0.055	0.018	O62486_CAEEL Nanos-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nos-3 PE=1 SV=1
17	Q23670	1.9	32.7	1520	0.099	0.019	TOP2_CAEEL DNA topoisomerase 2 top-2 OS=Caenorhabditis elegans OX=6239 GN=top-2 PE=1 SV=2
18	Q00013	3.3	31.6	466	0.072	0.045	EM55_HUMAN 55 kDa erythrocyte membrane protein OS=Homo sapiens OX=9606 GN=MPP1 PE=1 SV=2
19	P98203	5.8	31.2	962	0.051	0.016	ARVC_MOUSE Splicing regulator ARVCF OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2
20	P70290	6.1	30.8	466	0.072	0.045	EM55_MOUSE 55 kDa erythrocyte membrane protein OS=Mus musculus OX=10090 GN=Mpp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05741 zf-nanos	8.2e-22	88.5	Nanos RNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393275

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338173	0.994	Pumilio homolog 2
2	9606.ENSP00000320949	0.990	CCR4-NOT transcription complex subunit 1
3	9606.ENSP00000347444	0.865	Tudor domain-containing protein 7
4	9606.ENSP00000391723	0.844	Pumilio homolog 1
5	9606.ENSP00000317224	0.842	Protein Smaug homolog 2
6	9606.ENSP00000358716	0.842	Probable ATP-dependent RNA helicase DDX20
7	9606.ENSP00000250863	0.785	Deleted in azoospermia-like
8	9606.ENSP00000375919	0.757	Protein Smaug homolog 1
9	9606.ENSP00000263576	0.746	ATP-dependent RNA helicase DDX25
10	9606.ENSP00000445366	0.726	Dead end protein homolog 1
11	9606.ENSP00000409279	0.653	OTU domain-containing protein 4
12	9606.ENSP00000341346	0.651	Tektin-1
13	9606.ENSP00000245255	0.639	Piwi-like protein 1
14	9606.ENSP00000282369	0.604	E3 ubiquitin-protein ligase TRIM36
15	9606.ENSP00000296513	0.604	Adenosine deaminase domain-containing protein 1
16	9606.ENSP00000299001	0.600	Piwi-like protein 4
17	9606.ENSP00000222250	0.598	Arrestin domain containing 2
18	9606.ENSP00000264930	0.572	Solute carrier family 12 member 7
19	9606.ENSP00000349208	0.567	Piwi-like protein 2
20	9606.ENSP00000425658	0.562	Ankyrin repeat domain-containing protein 50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.416	organic cyclic compound binding
GO:1901363	0.406	heterocyclic compound binding
GO:0003676	0.397	nucleic acid binding
GO:0003723	0.315	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0010608	0.980	post-transcriptional regulation of gene expression
GO:0051252	0.966	regulation of RNA metabolic process
GO:0010605	0.957	negative regulation of macromolecule metabolic process
GO:0048523	0.956	negative regulation of cellular process
GO:0032501	0.952	multicellular organismal process
GO:1903311	0.937	regulation of mRNA metabolic process
GO:0048522	0.917	positive regulation of cellular process
GO:0009893	0.910	positive regulation of metabolic process
GO:0010556	0.871	regulation of macromolecule biosynthetic process
GO:0031326	0.871	regulation of cellular biosynthetic process
GO:0051246	0.860	regulation of protein metabolic process
GO:0009894	0.846	regulation of catabolic process
GO:0010604	0.844	positive regulation of macromolecule metabolic process
GO:0031325	0.844	positive regulation of cellular metabolic process
GO:0051172	0.841	negative regulation of nitrogen compound metabolic process
GO:0051173	0.837	positive regulation of nitrogen compound metabolic process
GO:0031329	0.827	regulation of cellular catabolic process
GO:0034249	0.827	negative regulation of amide metabolic process
GO:0031324	0.826	negative regulation of cellular metabolic process
GO:0010629	0.824	negative regulation of gene expression
GO:0006417	0.803	regulation of translation
GO:0061013	0.792	regulation of mRNA catabolic process
GO:2000113	0.785	negative regulation of cellular macromolecule biosynthetic process
GO:0051248	0.780	negative regulation of protein metabolic process
GO:0065008	0.752	regulation of biological quality
GO:0017148	0.743	negative regulation of translation
GO:0043487	0.723	regulation of RNA stability
GO:0043488	0.703	regulation of mRNA stability
GO:0045935	0.463	positive regulation of nucleobase-containing compound metabolic process
GO:0090130	0.430	tissue migration
GO:0061014	0.417	positive regulation of mRNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048471	0.995	perinuclear region of cytoplasm
GO:0043229	0.939	intracellular organelle
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0005634	0.850	nucleus
GO:0070013	0.515	intracellular organelle lumen
GO:0031981	0.425	nuclear lumen
GO:0043232	0.367	intracellular non-membrane-bounded organelle
GO:0005829	0.344	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]