StarFunc result for job id Q8WYA6

User Input

>input (563 residues)
MDVGELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEADDDKKRLL
QIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDI
IQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEG
AEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQG
LLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHN
PSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISRSSALKVLDHA
MIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRG
QQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEE
FYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI
GDGRSPEFRENEQKRILGLLENF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087WUB9	0.866	0.858	2.146E-62	568	0.993	0.984	A0A087WUB9.pdb.gz	A0A087WUB9_HUMAN Catenin beta like 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1
2	PDB:4hm9A	0.864	0.952	4.145E-57	511	0.908	1.000	4hm9A.pdb.gz
3	AFDB:Q9UUK1	0.787	0.786	2.492E-27	564	0.302	0.301	Q9UUK1.pdb.gz	CTBL1_SCHPO Beta-catenin-like protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctnnbl1 PE=1 SV=1
4	AFDB:Q9VM21	0.221	0.193	7.918E-8	669	0.153	0.129	Q9VM21.pdb.gz	GUDU_DROME Armadillo repeat-containing protein gudu OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1
5	AFDB:P14923	0.257	0.206	1.344E-7	745	0.133	0.101	P14923.pdb.gz	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
6	AFDB:P18824	0.383	0.277	1.457E-7	843	0.139	0.093	P18824.pdb.gz	ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1
7	AFDB:B9DHT4	0.422	0.349	1.581E-7	710	0.156	0.124	B9DHT4.pdb.gz	ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
8	AFDB:B2RY50	0.389	0.234	3.424E-7	1037	0.121	0.066	B2RY50.pdb.gz	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
9	AFDB:E1B8W3	0.311	0.201	3.424E-7	1044	0.146	0.079	E1B8W3.pdb.gz	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
10	AFDB:Q5T2S8	0.359	0.224	4.196E-7	1044	0.137	0.074	Q5T2S8.pdb.gz	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
11	AFDB:B7U179	0.400	0.322	4.938E-7	737	0.131	0.100	B7U179.pdb.gz	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
12	PDB:2z6gA	0.370	0.377	1.831E-6	550	0.108	0.111	2z6gA.pdb.gz
13	PDB:4r0zA	0.383	0.386	4.131E-6	557	0.126	0.127	4r0zA.pdb.gz
14	PDB:5tbkA	0.476	0.615	4.303E-6	417	0.112	0.151	5tbkA.pdb.gz
15	PDB:4tnmA	0.464	0.613	1.142E-5	407	0.107	0.147	4tnmA.pdb.gz
16	PDB:3tpoA	0.475	0.589	1.647E-5	438	0.099	0.128	3tpoA.pdb.gz
17	PDB:6kbnC	0.420	0.460	2.375E-5	504	0.124	0.139	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
18	PDB:7rroH7	0.234	0.229	2.375E-5	580	0.115	0.112	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:1wa5B	0.388	0.443	2.474E-5	466	0.094	0.114	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
20	PDB:7nscE	0.325	0.305	4.372E-5	615	0.137	0.125	7nscE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUB9	0.0	1135	568	0.996	0.988	A0A087WUB9_HUMAN Catenin beta like 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1
2	Q8WYA6	0.0	1143	563	1.000	1.000	CTBL1_HUMAN Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1
3	Q9CWL8	0.0	1064	563	0.961	0.961	CTBL1_MOUSE Beta-catenin-like protein 1 OS=Mus musculus OX=10090 GN=Ctnnbl1 PE=1 SV=1
4	A2A2P1	6.00e-111	330	166	0.295	1.000	A2A2P1_HUMAN Catenin beta like 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTNNBL1 PE=1 SV=1
5	Q9UUK1	7.80e-78	258	564	0.290	0.289	CTBL1_SCHPO Beta-catenin-like protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctnnbl1 PE=1 SV=1
6	D4ACL8	1.7	34.3	3064	0.052	0.009	D4ACL8_RAT Serine-protein kinase ATM OS=Rattus norvegicus OX=10116 GN=Atm PE=1 SV=1
7	Q54P24	4.2	32.7	1215	0.044	0.021	Q54P24_DICDI DH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcC PE=4 SV=1
8	Q45914	6.1	32.3	1193	0.039	0.018	BXAN_CLOBO Non-toxic nonhemagglutinin type A OS=Clostridium botulinum OX=1491 GN=ant PE=1 SV=1
9	A0A0G2JU09	6.5	32.3	3152	0.043	0.008	A0A0G2JU09_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
10	A0A8I5ZTE5	6.9	32.3	2998	0.043	0.008	A0A8I5ZTE5_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1
11	D3ZQ89	7.0	32.3	3034	0.043	0.008	D3ZQ89_RAT E1A binding protein p400 OS=Rattus norvegicus OX=10116 GN=Ep400 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	0.71	21.2	Armadillo/beta-catenin-like repeat
2	PF08216 CTNNBL	3.1e-181	614.6	Catenin-beta-like, Arm-motif containing nuclear
3	PF08650 DASH_Dad4	4.4e+02	12.3	DASH complex subunit Dad4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355050

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360532	0.999	Cell division cycle 5-like protein
2	9606.ENSP00000227524	0.997	Pre-mRNA-processing factor 19
3	9606.ENSP00000475615	0.997	Spliceosome-associated protein CWC15 homolog
4	9606.ENSP00000424417	0.987	Pleiotropic regulator 1
5	9606.ENSP00000358554	0.981	Pre-mRNA-splicing factor SPF27
6	9606.ENSP00000365439	0.975	Heterogeneous nuclear ribonucleoprotein K
7	9606.ENSP00000432083	0.964	Heat shock cognate 71 kDa protein
8	9606.ENSP00000307863	0.946	Splicing factor U2AF 65 kDa subunit
9	9606.ENSP00000349428	0.942	Polypyrimidine tract-binding protein 1
10	9606.ENSP00000485022	0.939	Splicing factor U2AF 35 kDa subunit
11	9606.ENSP00000325376	0.937	Heterogeneous nuclear ribonucleoprotein M
12	9606.ENSP00000349168	0.935	Heterogeneous nuclear ribonucleoprotein H
13	9606.ENSP00000261167	0.933	WW domain-binding protein 11
14	9606.ENSP00000346694	0.933	Heterogeneous nuclear ribonucleoproteins A2/B1
15	9606.ENSP00000221419	0.932	Heterogeneous nuclear ribonucleoprotein L
16	9606.ENSP00000324122	0.932	U4/U6 small nuclear ribonucleoprotein Prp31
17	9606.ENSP00000354346	0.931	Matrin-3
18	9606.ENSP00000258962	0.930	Serine/arginine-rich splicing factor 1
19	9606.ENSP00000349748	0.930	Splicing factor, proline- and glutamine-rich
20	9606.ENSP00000341826	0.924	Heterogeneous nuclear ribonucleoprotein A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.997	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010467	0.996	gene expression
GO:0050794	0.989	regulation of cellular process
GO:0048522	0.964	positive regulation of cellular process
GO:0048856	0.956	anatomical structure development
GO:0002440	0.917	production of molecular mediator of immune response
GO:0002200	0.916	somatic diversification of immune receptors
GO:0009987	0.854	cellular process
GO:0044238	0.814	primary metabolic process
GO:0006807	0.794	nitrogen compound metabolic process
GO:0044237	0.710	cellular metabolic process
GO:0034641	0.599	cellular nitrogen compound metabolic process
GO:0019222	0.538	regulation of metabolic process
GO:0010941	0.525	regulation of cell death
GO:0060255	0.522	regulation of macromolecule metabolic process
GO:0006139	0.492	nucleobase-containing compound metabolic process
GO:0042981	0.475	regulation of apoptotic process
GO:0090304	0.455	nucleic acid metabolic process
GO:0080090	0.426	regulation of primary metabolic process
GO:0010942	0.402	positive regulation of cell death
GO:0051171	0.397	regulation of nitrogen compound metabolic process
GO:0043068	0.388	positive regulation of programmed cell death
GO:0002377	0.387	immunoglobulin production
GO:0016445	0.378	somatic diversification of immunoglobulins
GO:0031323	0.364	regulation of cellular metabolic process
GO:0016070	0.307	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0015630	0.999	microtubule cytoskeleton
GO:0005813	0.989	centrosome
GO:0032991	0.981	protein-containing complex
GO:0016020	0.872	membrane
GO:0140513	0.863	nuclear protein-containing complex
GO:1990904	0.643	ribonucleoprotein complex
GO:0005681	0.572	spliceosomal complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]