StarFunc result for job id Q8WYH8

User Input

>input (240 residues)
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDF
ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP
VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WYH8	0.999	0.999	4.532E-39	240	1.000	1.000	Q8WYH8.pdb.gz	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
2	AFDB:Q8C0D7	0.576	0.556	1.328E-29	249	0.733	0.707	Q8C0D7.pdb.gz	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
3	AFDB:Q4VBS0	0.584	0.562	1.397E-28	250	0.675	0.648	Q4VBS0.pdb.gz	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
4	AFDB:Q9VJY8	0.523	0.444	6.278E-24	285	0.571	0.481	Q9VJY8.pdb.gz	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
5	AFDB:Q54PN9	0.435	0.324	1.327E-18	324	0.454	0.336	Q54PN9.pdb.gz	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
6	AFDB:Q9QXV3	0.440	0.382	2.623E-18	279	0.408	0.351	Q9QXV3.pdb.gz	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
7	AFDB:Q9ESK4	0.411	0.354	5.125E-17	281	0.350	0.299	Q9ESK4.pdb.gz	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
8	AFDB:Q9LIQ6	0.468	0.479	2.564E-16	234	0.308	0.316	Q9LIQ6.pdb.gz	ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana OX=3702 GN=ING1 PE=1 SV=1
9	AFDB:Q9NXR8	0.445	0.270	1.133E-15	418	0.383	0.220	Q9NXR8.pdb.gz	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
10	AFDB:Q5AHB8	0.421	0.343	2.837E-14	298	0.300	0.242	Q5AHB8.pdb.gz	YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YNG2 PE=3 SV=2
11	PDB:7vvuV	0.402	0.801	6.547E-4	113	0.083	0.177	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
12	PDB:6z6oC	0.363	0.175	2.500E-1	548	0.071	0.031	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
13	PDB:4q4aA	0.409	0.181	3.407E-1	572	0.046	0.019	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
14	PDB:7nsuD	0.296	0.190	3.407E-1	420	0.075	0.043	7nsuD.pdb.gz
15	PDB:6v4uB	0.204	0.132	3.625E-1	421	0.079	0.045	6v4uB.pdb.gz
16	PDB:6tuyA	0.249	0.109	3.856E-1	667	0.058	0.021	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
17	PDB:3k29A	0.241	0.345	4.102E-1	162	0.050	0.074	3k29A.pdb.gz
18	PDB:1serB	0.244	0.147	4.940E-1	421	0.050	0.029	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
19	PDB:5bw9g	0.311	0.475	4.940E-1	141	0.062	0.106	5bw9g.pdb.gz
20	PDB:2b5uA	0.259	0.164	5.948E-1	470	0.071	0.036	2b5uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WYH8	0.0	501	240	1.000	1.000	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
2	Q9D8Y8	8.83e-166	459	240	0.946	0.946	ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus OX=10090 GN=Ing5 PE=1 SV=1
3	Q8C0D7	7.27e-117	335	249	0.725	0.699	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
4	Q9UNL4	8.11e-117	335	249	0.725	0.699	ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens OX=9606 GN=ING4 PE=1 SV=1
5	Q4VBS0	2.17e-115	332	250	0.683	0.656	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
6	Q9VJY8	9.25e-86	258	285	0.554	0.467	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
7	Q9QXV3	2.16e-53	175	279	0.404	0.348	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
8	Q9ESK4	7.38e-44	150	281	0.362	0.310	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
9	Q9H160	2.66e-43	149	280	0.367	0.314	ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens OX=9606 GN=ING2 PE=1 SV=2
10	Q9UK53	2.48e-37	137	422	0.350	0.199	ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens OX=9606 GN=ING1 PE=1 SV=2
11	Q9LIQ6	2.47e-36	130	234	0.296	0.303	ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana OX=3702 GN=ING1 PE=1 SV=1
12	B3H615	1.11e-35	129	262	0.367	0.336	ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1
13	Q54PN9	4.52e-31	118	324	0.188	0.139	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
14	E7ET07	4.25e-28	112	403	0.167	0.099	E7ET07_HUMAN Inhibitor of growth protein OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=1
15	Q9NXR8	5.18e-28	112	418	0.167	0.096	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
16	Q9VEF5	4.90e-26	107	433	0.163	0.090	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
17	Q9VWS0	8.06e-24	101	686	0.146	0.051	Q9VWS0_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Ing3 PE=1 SV=1
18	F4HWW1	8.56e-23	96.7	328	0.317	0.232	F4HWW1_ARATH PHD finger protein-like protein OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1
19	O42871	3.11e-22	94.4	283	0.308	0.261	ING1_SCHPO Chromatin modification-related protein png1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=png1 PE=3 SV=1
20	Q5AHB8	3.18e-20	89.4	298	0.296	0.238	YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YNG2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20090 DUF6482	2.5e+02	13.0	Family of unknown function (DUF6482)
2	PF12998 ING	1.2e-28	111.0	Inhibitor of growth proteins N-terminal histone-binding
3	PF00628 PHD	0.0069	27.6	PHD-finger
4	PF09311 Rab5-bind	21	16.1	Rabaptin-like protein
5	PF13771 zf-HC5HC2H	66	15.2	PHD-like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000002061

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000016906	0.982	MYST/Esa1-associated factor 6
2	60711.ENSCSAP00000001508	0.965	K(lysine) acetyltransferase 7
3	60711.ENSCSAP00000014486	0.958	Jade family PHD finger 1
4	60711.ENSCSAP00000011159	0.940	K(lysine) acetyltransferase 6A
5	60711.ENSCSAP00000005308	0.939	K(lysine) acetyltransferase 6B
6	60711.ENSCSAP00000009748	0.926	Jade family PHD finger 2
7	60711.ENSCSAP00000007551	0.914	Acts as a tumor suppressor in many tumor types
8	60711.ENSCSAP00000006897	0.910	Bromodomain and PHD finger containing, 1
9	60711.ENSCSAP00000001441	0.905	Bromodomain containing 1
10	60711.ENSCSAP00000004254	0.831	K(lysine) acetyltransferase 5
11	60711.ENSCSAP00000017790	0.830	Belongs to the histone H3 family.
12	60711.ENSCSAP00000007785	0.815	Enhancer of polycomb homolog 1 (Drosophila)
13	60711.ENSCSAP00000012239	0.815	Enhancer of polycomb homolog 2 (Drosophila)
14	60711.ENSCSAP00000006430	0.814	Bromodomain and PHD finger containing, 3
15	60711.ENSCSAP00000011772	0.803	Histone deacetylase 2
16	60711.ENSCSAP00000013789	0.798	Transformation/transcription domain-associated protein
17	60711.ENSCSAP00000009921	0.785	Jade family PHD finger 3
18	60711.ENSCSAP00000016817	0.773	DNA methyltransferase 1 associated protein 1
19	60711.ENSCSAP00000016996	0.769	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
20	60711.ENSCSAP00000010915	0.756	RB binding protein 7, chromatin remodeling factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	0.997	methylated histone binding
GO:0003682	0.656	chromatin binding
GO:0140096	0.509	catalytic activity, acting on a protein
GO:0034212	0.439	peptide N-acetyltransferase activity
GO:0061733	0.427	peptide-lysine-N-acetyltransferase activity
GO:0004402	0.424	histone acetyltransferase activity
GO:1901363	0.326	heterocyclic compound binding
GO:0097159	0.326	organic cyclic compound binding
GO:0003676	0.303	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048522	0.990	positive regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048523	0.982	negative regulation of cellular process
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0080090	0.918	regulation of primary metabolic process
GO:0031323	0.917	regulation of cellular metabolic process
GO:0071704	0.915	organic substance metabolic process
GO:0019219	0.910	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.908	primary metabolic process
GO:0006807	0.887	nitrogen compound metabolic process
GO:0043170	0.861	macromolecule metabolic process
GO:0010942	0.832	positive regulation of cell death
GO:0010468	0.818	regulation of gene expression
GO:0042127	0.807	regulation of cell population proliferation
GO:0043067	0.786	regulation of programmed cell death
GO:0019538	0.765	protein metabolic process
GO:0071840	0.762	cellular component organization or biogenesis
GO:0042981	0.761	regulation of apoptotic process
GO:0010556	0.760	regulation of macromolecule biosynthetic process
GO:0031326	0.760	regulation of cellular biosynthetic process
GO:0036211	0.757	protein modification process
GO:0016043	0.729	cellular component organization
GO:0051252	0.721	regulation of RNA metabolic process
GO:0006355	0.710	regulation of DNA-templated transcription
GO:0043068	0.628	positive regulation of programmed cell death
GO:0016570	0.592	histone modification
GO:0018205	0.579	peptidyl-lysine modification
GO:0043065	0.576	positive regulation of apoptotic process
GO:0006473	0.572	protein acetylation
GO:0006325	0.562	chromatin organization
GO:0016573	0.546	histone acetylation
GO:0051052	0.545	regulation of DNA metabolic process
GO:0050896	0.521	response to stimulus
GO:0009893	0.467	positive regulation of metabolic process
GO:0010604	0.446	positive regulation of macromolecule metabolic process
GO:0048583	0.435	regulation of response to stimulus
GO:0031325	0.411	positive regulation of cellular metabolic process
GO:0051173	0.405	positive regulation of nitrogen compound metabolic process
GO:0051726	0.392	regulation of cell cycle
GO:0043967	0.384	histone H4 acetylation
GO:0009892	0.375	negative regulation of metabolic process
GO:0010605	0.367	negative regulation of macromolecule metabolic process
GO:0045935	0.366	positive regulation of nucleobase-containing compound metabolic process
GO:0031324	0.364	negative regulation of cellular metabolic process
GO:0051172	0.360	negative regulation of nitrogen compound metabolic process
GO:0010558	0.342	negative regulation of macromolecule biosynthetic process
GO:0031327	0.338	negative regulation of cellular biosynthetic process
GO:0051716	0.322	cellular response to stimulus
GO:0051128	0.307	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000123	0.997	histone acetyltransferase complex
GO:0005737	0.822	cytoplasm
GO:0005829	0.796	cytosol
GO:0070775	0.677	H3 histone acetyltransferase complex
GO:0140513	0.302	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.444	Transferring groups other than amino-acyl groups.
RHEA:21992	0.424	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.424	histone acetyltransferase.

[back to server]