StarFunc result for job id Q8WYK1

User Input

>input (1306 residues)
MDSLPRLTSVLTLLFSGLWHLGLTATNYNCDDPLASLLSPMAFSSSSDLTGTHSPAQLNW
RVGTGGWSPADSNAQQWLQMDLGNRVEITAVATQGRYGSSDWVTSYSLMFSDTGRNWKQY
KQEDSIWTFAGNMNADSVVHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSYKSDV
ADFDGRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQKGRLAL
HLNLGDSKARLSSSLPSATLGSLLDDQHWHSVLIERVGKQVNFTVDKHTQHFRTKGETDA
LDIDYELSFGGIPVPGKPGTFLKKNFHGCIENLYYNGVNIIDLAKRRKHQIYTGNVTFSC
SEPQIVPITFVNSSGSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTELSEGSGTLLLSL
EGGILRLVIQKMTERVAEILTGSNLNDGLWHSVSINARRNRITLTLDDEAAPPAPDSTWV
QIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCLPNYCEHGGSCSQSWTTFYCNCSDTSYTGATCHNSIYEQSCEVYRHQGNT
AGFFYIDSDGSGPLGPLQVYCNITEDKIWTSVQHNNTELTRVRGANPEKPYAMALDYGGS
MEQLEAVIDGSEHCEQEVAYHCRRSRLLNTPDGTPFTWWIGRSNERHPYWGGSPPGVQQC
ECGLDESCLDIQHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTDRSNSEAAWRIGP
LRCYGDRRFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIRL
EISSPSEITFAIDVGNGPVELVVQSPSLLNDNQWHYVRAERNLKETSLQVDNLPRSTRET
SEEGHFRLQLNSQLFVGGTSSRQKGFLGCIRSLHLNGQKMDLEERAKVTSGVRPGCPGHC
SSYGSICHNGGKCVEKHNGYLCDCTNSPYEGPFCKKEVSAVFEAGTSVTYMFQEPYPVTK
NISLSSSAIYTDSAPSKENIALSFVTTQAPSLLLFINSSSQDFVVVLLCKNGSLQVRYHL
NKEETHVFTIDADNFANRRMHHLKINREGRELTIQMDQQLRLSYNFSPEVEFRVIRSLTL
GKVTENLGLDSEVAKANAMGFAGCMSSVQYNHIAPLKAALRHATVAPVTVHGTLTESSCG
FMVDSDVNAVTTVHSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFCIIGIMTR
FLYQHKQSHRTSQMKEKEYPENLDSSFRNEIDLQNTVSECKREYFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY62	0.875	0.887	0.000	1287	0.514	0.521	E9PY62.pdb.gz	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
2	AFDB:O54991	0.649	0.614	0.000	1385	0.383	0.361	O54991.pdb.gz	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
3	AFDB:Q94887	0.618	0.628	0.000	1284	0.301	0.306	Q94887.pdb.gz	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
4	AFDB:Q99P47	0.855	0.853	0.000	1310	0.568	0.566	Q99P47.pdb.gz	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
5	AFDB:Q9C0A0	0.841	0.840	0.000	1308	0.577	0.576	Q9C0A0.pdb.gz	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
6	AFDB:Q9CPW0	0.832	0.816	0.000	1332	0.504	0.494	Q9CPW0.pdb.gz	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
7	AFDB:Q19617	0.523	0.573	1.501E-75	1180	0.222	0.246	Q19617.pdb.gz	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
8	AFDB:M9PE65	0.318	0.214	2.094E-70	2179	0.217	0.130	M9PE65.pdb.gz	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
9	AFDB:Q6P9K9	0.172	0.148	1.726E-60	1571	0.215	0.179	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
10	AFDB:B7ZD56	0.166	0.138	4.277E-60	1670	0.220	0.172	B7ZD56.pdb.gz
11	PDB:2w94A	0.099	0.482	1.358E-7	254	0.036	0.185	2w94A.pdb.gz	Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
12	PDB:4bxsV	0.106	0.110	1.643E-7	1262	0.045	0.047	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	PDB:2vmeA	0.102	0.476	3.058E-7	256	0.038	0.195	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
14	PDB:3jd6O	0.105	0.761	8.746E-7	167	0.034	0.263	3jd6O.pdb.gz
15	PDB:7kveB	0.106	0.101	1.479E-6	1374	0.041	0.039	7kveB.pdb.gz
16	PDB:3v0aB	0.105	0.117	2.273E-6	1150	0.034	0.038	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
17	PDB:7zl1A	0.106	0.542	1.690E-5	215	0.021	0.130	7zl1A.pdb.gz
18	PDB:3ffzA	0.086	0.089	3.630E-5	1246	0.022	0.023	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
19	PDB:4pbpB	0.108	0.575	6.138E-5	210	0.026	0.162	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
20	PDB:6m5yA	0.076	0.294	2.125E-4	270	0.025	0.122	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GH02	0.0	1318	1332	0.508	0.498	A0A8I6GH02_RAT Contactin associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cntnap2 PE=3 SV=1
2	D8WUA6	0.0	1324	1328	0.499	0.491	D8WUA6_TAEGU Contactin associated protein-like 2 OS=Taeniopygia guttata OX=59729 GN=CNTNAP2 PE=2 SV=1
3	E9PY62	0.0	1356	1287	0.512	0.520	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
4	O54991	0.0	933	1385	0.374	0.352	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
5	P78357	0.0	943	1384	0.383	0.361	CNTP1_HUMAN Contactin-associated protein 1 OS=Homo sapiens OX=9606 GN=CNTNAP1 PE=1 SV=1
6	P97846	0.0	923	1381	0.374	0.354	CNTP1_RAT Contactin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Cntnap1 PE=1 SV=1
7	Q94887	0.0	620	1284	0.306	0.311	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
8	Q99P47	0.0	1540	1310	0.568	0.566	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
9	Q9C0A0	0.0	1593	1308	0.583	0.583	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
10	Q9CPW0	0.0	1326	1332	0.510	0.500	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
11	Q9UHC6	0.0	1324	1331	0.508	0.499	CNTP2_HUMAN Contactin-associated protein-like 2 OS=Homo sapiens OX=9606 GN=CNTNAP2 PE=1 SV=1
12	Q3URC6	2.39e-163	499	510	0.191	0.488	Q3URC6_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cntnap3 PE=2 SV=1
13	Q19617	2.21e-68	254	1180	0.221	0.244	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
14	M9PE65	1.43e-60	231	2179	0.181	0.108	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
15	Q9XYX0	4.51e-47	187	1685	0.168	0.131	Q9XYX0_DROME AXO OS=Drosophila melanogaster OX=7227 GN=axo PE=2 SV=1
16	A1XQX4	4.66e-29	129	1670	0.092	0.072	A1XQX4_DANRE Neurexin 2a alpha OS=Danio rerio OX=7955 GN=nrxn2a PE=2 SV=1
17	A0A1D5RMU6	1.27e-28	127	1499	0.094	0.082	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
18	A0A0R4J2G7	1.35e-28	127	1495	0.094	0.082	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
19	A0A0B4KH61	1.14e-26	121	1525	0.076	0.065	A0A0B4KH61_DROME Neurexin 1, isoform G OS=Drosophila melanogaster OX=7227 GN=Nrx-1 PE=4 SV=1
20	A1XQX0	1.31e-26	121	1491	0.081	0.071	NR1AA_DANRE Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	0.92	21.2	EGF-like domain
2	PF07974 EGF_2	22	16.8	EGF-like domain
3	PF00754 F5_F8_type_C	2.9e-25	100.3	F5/8 type C domain
4	PF00054 Laminin_G_1	7.6e-59	209.0	Laminin G domain
5	PF02210 Laminin_G_2	3.4e-89	307.3	Laminin G domain
6	PF13385 Laminin_G_3	1.3e-06	40.1	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307860	0.716	Disrupted in renal carcinoma 1
2	9606.ENSP00000263956	0.707	General transcription factor 3C polypeptide 3
3	9606.ENSP00000380602	0.664	Contactin-4
4	9606.ENSP00000435637	0.664	Contactin-5
5	9606.ENSP00000262231	0.624	Regulating synaptic membrane exocytosis protein 2
6	9606.ENSP00000361800	0.617	WD repeat-containing protein 34
7	9606.ENSP00000361238	0.615	Radial spoke head 9 homolog
8	9606.ENSP00000347719	0.608	Tubulin-specific chaperone D
9	9606.ENSP00000330633	0.580	Contactin-2
10	9606.ENSP00000449629	0.568	Ankyrin repeat and sterile alpha motif domain-containing protein 1B
11	9606.ENSP00000344786	0.554	Neurofascin
12	9606.ENSP00000284262	0.527	Junctophilin-3
13	9606.ENSP00000391311	0.527	Septin-5
14	9606.ENSP00000407822	0.523	Contactin-6
15	9606.ENSP00000263665	0.517	Contactin-3
16	9606.ENSP00000377446	0.515	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
17	9606.ENSP00000346335	0.505	Protein NRDE2 homolog
18	9606.ENSP00000478830	0.505	Transmembrane protease serine 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030165	0.316	PDZ domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.988	regulation of biological process
GO:0032501	0.977	multicellular organismal process
GO:0048856	0.959	anatomical structure development
GO:0050794	0.950	regulation of cellular process
GO:0007275	0.889	multicellular organism development
GO:0048731	0.843	system development
GO:0007399	0.829	nervous system development
GO:0071840	0.479	cellular component organization or biogenesis
GO:0016043	0.436	cellular component organization
GO:0050896	0.417	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0120025	0.998	plasma membrane bounded cell projection
GO:0016020	0.996	membrane
GO:0071944	0.991	cell periphery
GO:0043005	0.988	neuron projection
GO:0005886	0.981	plasma membrane
GO:0036477	0.922	somatodendritic compartment
GO:0030424	0.914	axon
GO:0030054	0.854	cell junction
GO:0044297	0.765	cell body
GO:0043025	0.752	neuronal cell body
GO:0045202	0.751	synapse
GO:0005622	0.740	intracellular anatomical structure
GO:0043226	0.734	organelle
GO:0098590	0.687	plasma membrane region
GO:0043229	0.583	intracellular organelle
GO:0043227	0.554	membrane-bounded organelle
GO:0005737	0.553	cytoplasm
GO:0098793	0.402	presynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]