StarFunc result for job id Q8WYK2

User Input

>input (163 residues)
MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKR
PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE
LKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97875	0.722	0.722	1.539E-20	163	0.963	0.963	P97875.pdb.gz	JDP2_MOUSE Jun dimerization protein 2 OS=Mus musculus OX=10090 GN=Jdp2 PE=1 SV=2
2	AFDB:Q4ZJF0	0.456	0.221	2.621E-2	349	0.282	0.132	Q4ZJF0.pdb.gz
3	AFDB:H0ZPP9	0.438	0.224	3.481E-2	335	0.270	0.131	H0ZPP9.pdb.gz	H0ZPP9_TAEGU Fos proto-oncogene, AP-1 transcription factor subunit OS=Taeniopygia guttata OX=59729 GN=FOS PE=4 SV=2
4	AFDB:B8ZZU6	0.418	0.184	1.657E-1	389	0.215	0.090	B8ZZU6.pdb.gz	B8ZZU6_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=1
5	AFDB:P52890	0.381	0.122	2.049E-1	566	0.178	0.051	P52890.pdb.gz	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
6	AFDB:P15336	0.402	0.137	2.361E-1	505	0.227	0.073	P15336.pdb.gz	ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4
7	AFDB:Q9C7S0	0.383	0.216	2.361E-1	295	0.215	0.119	Q9C7S0.pdb.gz	BZP60_ARATH bZIP transcription factor 60 OS=Arabidopsis thaliana OX=3702 GN=BZIP60 PE=1 SV=1
8	AFDB:A7RIQ6	0.426	0.216	5.151E-1	343	0.184	0.087	A7RIQ6.pdb.gz	A7RIQ6_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g238589 PE=1 SV=1
9	AFDB:P17535	0.418	0.209	5.151E-1	347	0.178	0.084	P17535.pdb.gz	JUND_HUMAN Transcription factor JunD OS=Homo sapiens OX=9606 GN=JUND PE=1 SV=3
10	AFDB:Q94126	0.351	0.275	7.344E-1	211	0.196	0.152	Q94126.pdb.gz	CES2_CAEEL Transcription factor ces-2 OS=Caenorhabditis elegans OX=6239 GN=ces-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WYK2	4.35e-115	324	163	1.000	1.000	JDP2_HUMAN Jun dimerization protein 2 OS=Homo sapiens OX=9606 GN=JDP2 PE=1 SV=1
2	P97875	2.53e-111	315	163	0.963	0.963	JDP2_MOUSE Jun dimerization protein 2 OS=Mus musculus OX=10090 GN=Jdp2 PE=1 SV=2
3	Q78E65	2.53e-111	315	163	0.963	0.963	JDP2_RAT Jun dimerization protein 2 OS=Rattus norvegicus OX=10116 GN=Jdp2 PE=1 SV=1
4	P29596	6.88e-31	112	181	0.515	0.464	ATF3_RAT Cyclic AMP-dependent transcription factor ATF-3 OS=Rattus norvegicus OX=10116 GN=Atf3 PE=2 SV=1
5	Q5VTZ4	1.57e-30	110	175	0.325	0.303	Q5VTZ4_HUMAN Activating transcription factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=1
6	P18847	1.88e-30	110	181	0.325	0.293	ATF3_HUMAN Cyclic AMP-dependent transcription factor ATF-3 OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=2
7	Q60765	2.33e-30	110	181	0.325	0.293	ATF3_MOUSE Cyclic AMP-dependent transcription factor ATF-3 OS=Mus musculus OX=10090 GN=Atf3 PE=2 SV=1
8	Q7ZVX7	6.85e-27	102	202	0.294	0.238	Q7ZVX7_DANRE Activating transcription factor 3 OS=Danio rerio OX=7955 GN=zgc:55526 PE=2 SV=1
9	F6WD51	8.73e-15	71.6	273	0.221	0.132	F6WD51_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=atf3 PE=1 SV=2
10	Q6P0S4	2.06e-14	71.2	349	0.215	0.100	Q6P0S4_DANRE Proto-oncogene c-Fos OS=Danio rerio OX=7955 GN=fos PE=2 SV=1
11	P48755	1.60e-12	65.5	273	0.190	0.114	FOSL1_MOUSE Fos-related antigen 1 OS=Mus musculus OX=10090 GN=Fosl1 PE=1 SV=2
12	P10158	2.57e-12	65.1	275	0.178	0.105	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
13	A0A0S2Z595	4.46e-12	64.3	271	0.178	0.107	A0A0S2Z595_HUMAN FOS-like antigen 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FOSL1 PE=2 SV=1
14	P15407	4.46e-12	64.3	271	0.178	0.107	FOSL1_HUMAN Fos-related antigen 1 OS=Homo sapiens OX=9606 GN=FOSL1 PE=1 SV=1
15	Q4H3J9	7.17e-12	64.3	501	0.184	0.060	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
16	P21525	2.21e-11	63.2	755	0.209	0.045	FOSLA_DROME Transcription factor kayak, isoforms A/B/F OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=4
17	A8MPH9	2.37e-11	63.2	722	0.209	0.047	FOSLD_DROME Transcription factor kayak, isoforms D/sro OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=2
18	A2RUX8	5.60e-11	61.6	341	0.178	0.085	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
19	Q16520	1.13e-10	58.2	125	0.184	0.240	BATF_HUMAN Basic leucine zipper transcriptional factor ATF-like OS=Homo sapiens OX=9606 GN=BATF PE=1 SV=1
20	P12841	1.50e-10	60.5	380	0.166	0.071	FOS_RAT Protein c-Fos OS=Rattus norvegicus OX=10116 GN=Fos PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	2.1e-07	42.3	bZIP transcription factor
2	PF07716 bZIP_2	0.00021	32.6	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.0013	30.6	bZIP Maf transcription factor
4	PF09659 Cas_Csm6	1.7e+02	12.4	CRISPR-associated protein (Cas_Csm6)
5	PF03961 FapA	6.8e+02	11.3	Flagellar Assembly Protein A beta solenoid domain
6	PF09726 Macoilin	5.1e+02	10.6	Macoilin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267569

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360266	0.994	Transcription factor AP-1
2	9606.ENSP00000264110	0.988	Cyclic AMP-dependent transcription factor ATF-2
3	9606.ENSP00000306245	0.919	Proto-oncogene c-Fos
4	9606.ENSP00000339754	0.909	ADP-ribosylation factor-like protein 4C
5	9606.ENSP00000325120	0.898	Progesterone receptor
6	9606.ENSP00000252818	0.867	Transcription factor jun-D
7	9606.ENSP00000303315	0.866	Transcription factor jun-B
8	9606.ENSP00000448665	0.837	DNA damage-inducible transcript 3 protein
9	9606.ENSP00000302967	0.792	Histone deacetylase 3
10	9606.ENSP00000256196	0.680	Ras-related protein R-Ras2
11	9606.ENSP00000334061	0.680	Histone deacetylase 6
12	9606.ENSP00000380252	0.671	Nuclear factor erythroid 2-related factor 2
13	9606.ENSP00000249396	0.652	NAD-dependent protein deacetylase sirtuin-2
14	9606.ENSP00000394560	0.623	Mitogen-activated protein kinase 9
15	9606.ENSP00000271651	0.614	Cathepsin K
16	9606.ENSP00000332973	0.596	Mothers against decapentaplegic homolog 3
17	9606.ENSP00000344903	0.588	Transcription factor MafK
18	9606.ENSP00000307265	0.587	Interferon regulatory factor 2-binding protein 1
19	9606.ENSP00000399465	0.579	Cyclic AMP-dependent transcription factor ATF-7
20	9606.ENSP00000375919	0.565	Protein Smaug homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000977	0.993	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0046982	0.980	protein heterodimerization activity
GO:0000978	0.980	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.975	identical protein binding
GO:0042803	0.887	protein homodimerization activity
GO:0003682	0.885	chromatin binding
GO:0019904	0.879	protein domain specific binding
GO:0030275	0.850	LRR domain binding
GO:0001216	0.595	DNA-binding transcription activator activity
GO:0035497	0.546	cAMP response element binding
GO:0001228	0.531	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043522	0.506	leucine zipper domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0048523	0.968	negative regulation of cellular process
GO:0006357	0.964	regulation of transcription by RNA polymerase II
GO:0010605	0.914	negative regulation of macromolecule metabolic process
GO:0045892	0.889	negative regulation of DNA-templated transcription
GO:0009987	0.884	cellular process
GO:0000122	0.864	negative regulation of transcription by RNA polymerase II
GO:0048518	0.822	positive regulation of biological process
GO:0010604	0.767	positive regulation of macromolecule metabolic process
GO:0051173	0.722	positive regulation of nitrogen compound metabolic process
GO:0048522	0.518	positive regulation of cellular process
GO:0032502	0.381	developmental process
GO:0031325	0.380	positive regulation of cellular metabolic process
GO:0050793	0.313	regulation of developmental process
GO:0050896	0.307	response to stimulus
GO:0045935	0.305	positive regulation of nucleobase-containing compound metabolic process
GO:0045944	0.302	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.992	protein-containing complex
GO:0140513	0.957	nuclear protein-containing complex
GO:0005667	0.948	transcription regulator complex
GO:0031981	0.948	nuclear lumen
GO:0090575	0.942	RNA polymerase II transcription regulator complex
GO:0005654	0.890	nucleoplasm
GO:0005737	0.338	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]