StarFunc result for job id Q8WYL5

User Input

>input (1049 residues)
MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQG
QRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTE
ENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWS
ALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPAL
FVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEML
LILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRV
YDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAY
NYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFL
PETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREAL
LEEAAPPAEVHRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGR
WGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCADCMYPTASGA
PEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGS
RRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPK
KDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPA
PPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPP
FFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIET
RLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQG
TPRDPAATSKPSGKPAPENLKSPSWMSKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LWM1	0.387	0.392	0.000	1032	0.780	0.793	F1LWM1.pdb.gz	F1LWM1_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=1 SV=3
2	AFDB:Q8WYL5	0.999	0.999	0.000	1049	1.000	1.000	Q8WYL5.pdb.gz	SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens OX=9606 GN=SSH1 PE=1 SV=2
3	AFDB:Q76I76	0.383	0.292	6.507E-70	1423	0.409	0.301	Q76I76.pdb.gz	SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1
4	AFDB:F1M4Q5	0.345	0.260	6.118E-66	1430	0.403	0.296	F1M4Q5.pdb.gz	F1M4Q5_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=2
5	AFDB:Q8TE77	0.359	0.554	1.892E-55	659	0.241	0.384	Q8TE77.pdb.gz	SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3 PE=1 SV=2
6	AFDB:Q6NN85	0.181	0.181	6.998E-53	1045	0.309	0.310	Q6NN85.pdb.gz	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
7	PDB:6d66A	0.141	0.284	9.387E-14	517	0.052	0.106	6d66A.pdb.gz
8	PDB:2wgpA	0.136	0.829	1.551E-13	168	0.053	0.333	2wgpA.pdb.gz
9	AFDB:Q10038	0.142	0.223	6.241E-13	657	0.111	0.177	Q10038.pdb.gz	VHP1_CAEEL Tyrosine-protein phosphatase vhp-1 OS=Caenorhabditis elegans OX=6239 GN=vhp-1 PE=1 SV=2
10	PDB:5y15A	0.133	0.903	1.033E-12	148	0.050	0.351	5y15A.pdb.gz
11	PDB:2esbA	0.135	0.854	4.660E-12	162	0.042	0.272	2esbA.pdb.gz
12	PDB:2y96A	0.135	0.754	6.315E-10	175	0.053	0.320	2y96A.pdb.gz
13	PDB:3f81A	0.134	0.753	2.038E-9	179	0.042	0.246	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
14	PDB:2gwoC	0.133	0.760	6.219E-9	174	0.044	0.264	2gwoC.pdb.gz
15	PDB:5xjvB	0.127	0.743	3.706E-8	171	0.045	0.275	5xjvB.pdb.gz
16	PDB:2q05A	0.118	0.627	1.581E-7	181	0.038	0.221	2q05A.pdb.gz
17	PDB:4ercA	0.118	0.760	2.175E-6	150	0.022	0.153	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
18	AFDB:Q6DFV3	0.075	0.046	2.104E-4	1944	0.141	0.076	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
19	AFDB:P42684	0.072	0.067	2.225E-4	1182	0.138	0.123	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
20	AFDB:Q5T5U3	0.072	0.044	4.346E-4	1958	0.148	0.079	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A2G7	0.0	1585	997	0.780	0.820	A0A8I6A2G7_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=3 SV=1
2	A0A8I6AIB0	0.0	1583	1018	0.799	0.823	A0A8I6AIB0_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=3 SV=1
3	A0A8I6APG2	0.0	623	1422	0.279	0.206	A0A8I6APG2_RAT Slingshot protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=1
4	A0A8I6ATT8	0.0	692	1423	0.318	0.235	A0A8I6ATT8_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=1
5	A0A8I6B0P9	0.0	1636	1053	0.820	0.817	A0A8I6B0P9_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=3 SV=1
6	F1LWM1	0.0	1594	1032	0.786	0.798	F1LWM1_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh1 PE=1 SV=3
7	F1M4Q5	0.0	678	1430	0.299	0.220	F1M4Q5_RAT protein-serine/threonine phosphatase OS=Rattus norvegicus OX=10116 GN=Ssh2 PE=1 SV=2
8	Q76I76	0.0	695	1423	0.318	0.235	SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1
9	Q8WYL5	0.0	2157	1049	1.000	1.000	SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens OX=9606 GN=SSH1 PE=1 SV=2
10	Q8TE77	8.00e-141	439	659	0.223	0.355	SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3 PE=1 SV=2
11	Q6NN85	2.75e-130	423	1045	0.193	0.193	SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster OX=7227 GN=ssh PE=1 SV=2
12	Q9ZR37	1.46e-28	115	198	0.060	0.318	DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1
13	Q05923	1.29e-26	114	314	0.051	0.172	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
14	Q05922	2.06e-26	113	318	0.051	0.170	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
15	Q91790	1.03e-24	109	369	0.051	0.146	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
16	Q13115	1.41e-24	109	394	0.062	0.165	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
17	P28563	3.58e-24	107	367	0.051	0.144	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
18	Q99956	3.58e-24	108	384	0.066	0.180	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
19	Q64623	4.04e-24	107	367	0.051	0.144	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
20	Q556Y8	4.05e-24	109	476	0.047	0.103	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08766 DEK_C	2.1e-10	51.7	DEK C terminal domain
2	PF00782 DSPc	4.7e-31	118.8	Dual specificity phosphatase, catalytic domain
3	PF00102 Y_phosphatase	65	14.5	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315713

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000432660	0.993	Cofilin-1
2	9606.ENSP00000469413	0.967	Serine/threonine-protein kinase PAK 4
3	9606.ENSP00000336740	0.939	LIM domain kinase 1
4	9606.ENSP00000298159	0.924	Cofilin-2
5	9606.ENSP00000379287	0.924	14-3-3 protein zeta/delta
6	9606.ENSP00000376345	0.908	Growth factor receptor-bound protein 2
7	9606.ENSP00000410294	0.906	Fibroblast growth factor receptor 2
8	9606.ENSP00000386884	0.905	C-X-C chemokine receptor type 4
9	9606.ENSP00000379140	0.902	Stromal cell-derived factor 1
10	9606.ENSP00000480791	0.900	Fibroblast growth factor 1
11	9606.ENSP00000361930	0.894	14-3-3 protein beta/alpha
12	9606.ENSP00000312081	0.825	Protein phosphatase Slingshot homolog 3
13	9606.ENSP00000444743	0.825	Protein phosphatase Slingshot homolog 2
14	9606.ENSP00000362924	0.797	Gelsolin
15	9606.ENSP00000339916	0.785	LIM domain kinase 2
16	9606.ENSP00000246069	0.765	Destrin
17	9606.ENSP00000215904	0.720	Pyridoxal phosphate phosphatase
18	9606.ENSP00000264255	0.716	Thioredoxin domain-containing protein 9
19	9606.ENSP00000333568	0.712	Serine/threonine-protein kinase D1
20	9606.ENSP00000295770	0.711	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0004721	1.000	phosphoprotein phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0048522	0.991	positive regulation of cellular process
GO:2000145	0.988	regulation of cell motility
GO:0007154	0.985	cell communication
GO:0023052	0.982	signaling
GO:0030334	0.981	regulation of cell migration
GO:0010646	0.971	regulation of cell communication
GO:0023051	0.967	regulation of signaling
GO:0030335	0.967	positive regulation of cell migration
GO:0048583	0.963	regulation of response to stimulus
GO:0065008	0.951	regulation of biological quality
GO:0032879	0.930	regulation of localization
GO:0009966	0.873	regulation of signal transduction
GO:0010941	0.856	regulation of cell death
GO:0014910	0.854	regulation of smooth muscle cell migration
GO:0050896	0.851	response to stimulus
GO:0060341	0.809	regulation of cellular localization
GO:0032880	0.790	regulation of protein localization
GO:0014911	0.773	positive regulation of smooth muscle cell migration
GO:1901214	0.755	regulation of neuron death
GO:0051716	0.742	cellular response to stimulus
GO:0048167	0.730	regulation of synaptic plasticity
GO:0042391	0.727	regulation of membrane potential
GO:0048584	0.726	positive regulation of response to stimulus
GO:0008152	0.722	metabolic process
GO:0051128	0.720	regulation of cellular component organization
GO:0044237	0.702	cellular metabolic process
GO:1905475	0.689	regulation of protein localization to membrane
GO:0051239	0.681	regulation of multicellular organismal process
GO:0071704	0.669	organic substance metabolic process
GO:0031644	0.653	regulation of nervous system process
GO:1901564	0.640	organonitrogen compound metabolic process
GO:0043170	0.639	macromolecule metabolic process
GO:0044238	0.638	primary metabolic process
GO:0071840	0.636	cellular component organization or biogenesis
GO:0043412	0.629	macromolecule modification
GO:0016043	0.625	cellular component organization
GO:0019538	0.621	protein metabolic process
GO:0036211	0.611	protein modification process
GO:0051130	0.579	positive regulation of cellular component organization
GO:0009967	0.562	positive regulation of signal transduction
GO:1903829	0.556	positive regulation of protein localization
GO:0006793	0.519	phosphorus metabolic process
GO:0006796	0.508	phosphate-containing compound metabolic process
GO:0042221	0.485	response to chemical
GO:0098815	0.465	modulation of excitatory postsynaptic potential
GO:1905477	0.442	positive regulation of protein localization to membrane
GO:0006996	0.422	organelle organization
GO:0098916	0.419	anterograde trans-synaptic signaling
GO:0019222	0.411	regulation of metabolic process
GO:0007268	0.407	chemical synaptic transmission
GO:1901216	0.406	positive regulation of neuron death
GO:0007165	0.367	signal transduction
GO:0060255	0.363	regulation of macromolecule metabolic process
GO:0080090	0.361	regulation of primary metabolic process
GO:0051171	0.361	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.988	membrane
GO:0005886	0.980	plasma membrane
GO:0042995	0.945	cell projection
GO:0120025	0.935	plasma membrane bounded cell projection
GO:0031252	0.891	cell leading edge
GO:0030427	0.780	site of polarized growth
GO:0150034	0.736	distal axon
GO:0030426	0.719	growth cone
GO:0043229	0.641	intracellular organelle
GO:0043231	0.465	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]