StarFunc result for job id Q8WYP3

User Input

>input (895 residues)
MTAWTMGARGLDKRGSFFKLIDTIASEIGELKQEMVRTDVNLENGLEPAETHSMVRHKDG
GYSEEEDVKTCARDSGYDSLSNRLSILDRLLHTHPIWLQLSLSEEEAAEVLQAQPPGIFL
VHKSTKMQKKVLSLRLPCEFGAPLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCISRD
VLPFTLKLPYAISTAKSEAQLEELAQMGLNFWSSPADSKPPNLPPPHRPLSSDGVCPASL
RQLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVHSQDLSGGLKRPSTRTPNANG
TERTRSPPPRPPPPAINSLHTSPRLARTETQTSMPETVNHNKHGNVALPGTKPTPIPPPR
LKKQASFLEAEGGAKTLSGGRPGAGPELELGTAGSPGGAPPEAAPGDCTRAPPPSSESRP
PCHGGRQRLSDMSISTSSSDSLEFDRSMPLFGYEADTNSSLEDYEGESDQETMAPPIKSK
KKRSSSFVLPKLVKSQLQKVSGVFSSFMTPEKRMVRRIAELSRDKCTYFGCLVQDYVSFL
QENKECHVSSTDMLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQIDVVLEKAMHKCIL
KPLKGHVEAMLKDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPDFVDVEKIKVKFMT
MQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGADDFLPVLTYVIAQCDMLELDTEIEY
MMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRDTLRQWHKRRTTNRT
IPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFV
DETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WYP3	1.000	1.000	0.000	895	1.000	1.000	Q8WYP3.pdb.gz	RIN2_HUMAN Ras and Rab interactor 2 OS=Homo sapiens OX=9606 GN=RIN2 PE=1 SV=1
2	AFDB:P59729	0.294	0.269	1.250E-42	980	0.340	0.310	P59729.pdb.gz	RIN3_MOUSE Ras and Rab interactor 3 OS=Mus musculus OX=10090 GN=Rin3 PE=1 SV=2
3	AFDB:Q8MQW8	0.265	0.136	1.487E-25	1789	0.251	0.126	Q8MQW8.pdb.gz	SPRI_DROME Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3
4	PDB:4k2rA	0.098	0.155	8.931E-3	551	0.034	0.054	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
5	PDB:3qwyA	0.099	0.458	1.388E-2	170	0.023	0.124	3qwyA.pdb.gz
6	PDB:4fl2A	0.094	0.150	1.585E-2	555	0.026	0.041	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
7	AFDB:Q9UQB3	0.080	0.066	2.990E-2	1225	0.133	0.097	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
8	PDB:5xzrA	0.083	0.141	3.666E-2	519	0.021	0.037	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
9	PDB:6aafA	0.085	0.503	4.373E-2	112	0.023	0.188	6aafA.pdb.gz	Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein
10	AFDB:Q99569	0.072	0.060	5.077E-2	1192	0.094	0.070	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
11	PDB:6lanA	0.085	0.450	5.453E-2	133	0.013	0.090	6lanA.pdb.gz
12	PDB:7yo8A	0.084	0.403	5.453E-2	140	0.025	0.157	7yo8A.pdb.gz
13	AFDB:P25822	0.066	0.045	5.796E-2	1533	0.094	0.055	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
14	AFDB:Q09763	0.077	0.088	5.796E-2	753	0.111	0.131	Q09763.pdb.gz	GEF1_SCHPO Rho guanine nucleotide exchange factor gef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gef1 PE=1 SV=1
15	PDB:2lqnA	0.086	0.232	7.106E-2	303	0.025	0.073	2lqnA.pdb.gz
16	AFDB:A0A1D8PLL4	0.063	0.059	7.553E-2	1027	0.128	0.112	A0A1D8PLL4.pdb.gz	A0A1D8PLL4_CANAL Rgt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RGT1 PE=4 SV=1
17	PDB:5azhA	0.088	0.467	8.478E-2	127	0.018	0.126	5azhA.pdb.gz
18	AFDB:O35927	0.090	0.072	8.622E-2	1247	0.134	0.096	O35927.pdb.gz	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
19	AFDB:Q0DRX6	0.082	0.082	1.174E-1	902	0.078	0.078	Q0DRX6.pdb.gz	CWZF3_ORYSJ Cysteine-tryptophan domain-containing zinc finger protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CWZF3 PE=1 SV=1
20	PDB:3h9dA	0.077	0.434	1.207E-1	116	0.015	0.112	3h9dA.pdb.gz	Trypanosoma brucei ATG8: structural insights into autophagic-like mechanisms in protozoa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WYP3	0.0	1857	895	1.000	1.000	RIN2_HUMAN Ras and Rab interactor 2 OS=Homo sapiens OX=9606 GN=RIN2 PE=1 SV=1
2	Q6NSK7	7.94e-91	310	908	0.227	0.224	Q6NSK7_HUMAN RIN3 protein OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=1
3	Q8TB24	4.09e-90	309	985	0.227	0.206	RIN3_HUMAN Ras and Rab interactor 3 OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=4
4	P59729	8.33e-86	297	980	0.200	0.183	RIN3_MOUSE Ras and Rab interactor 3 OS=Mus musculus OX=10090 GN=Rin3 PE=1 SV=2
5	Q921Q7	6.85e-67	240	763	0.151	0.177	RIN1_MOUSE Ras and Rab interactor 1 OS=Mus musculus OX=10090 GN=Rin1 PE=1 SV=1
6	Q13671	4.98e-64	232	783	0.161	0.184	RIN1_HUMAN Ras and Rab interactor 1 OS=Homo sapiens OX=9606 GN=RIN1 PE=1 SV=4
7	Q8MQW8	1.16e-37	155	1789	0.117	0.059	SPRI_DROME Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3
8	Q80UW3	3.79e-28	122	563	0.095	0.151	RINL_MOUSE Ras and Rab interactor-like protein OS=Mus musculus OX=10090 GN=Rinl PE=1 SV=1
9	G5ECF0	6.08e-28	124	1890	0.123	0.058	G5ECF0_CAEEL SH2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rin-1 PE=1 SV=1
10	Q9W0H9	2.63e-10	66.6	696	0.034	0.043	Q9W0H9_DROME Rabaptin-5-associated exchange factor for Rab5 OS=Drosophila melanogaster OX=7227 GN=Rabex-5 PE=1 SV=1
11	P54787	5.45e-09	62.0	451	0.055	0.109	VPS9_YEAST Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS9 PE=1 SV=2
12	Q9UJ41	6.42e-08	58.5	491	0.047	0.086	RABX5_HUMAN Rab5 GDP/GTP exchange factor OS=Homo sapiens OX=9606 GN=RABGEF1 PE=1 SV=3
13	E9PFK9	7.16e-08	58.5	504	0.047	0.083	E9PFK9_HUMAN RAB guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RABGEF1 PE=1 SV=1
14	Q9VRS2	1.09e-07	57.8	474	0.038	0.072	Q9VRS2_DROME PVR adaptor protein OS=Drosophila melanogaster OX=7227 GN=PVRAP PE=2 SV=2
15	Q9JM13	1.51e-07	57.4	491	0.039	0.071	RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus OX=10090 GN=Rabgef1 PE=1 SV=1
16	O18973	6.47e-07	55.5	492	0.038	0.069	RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus OX=9913 GN=RABGEF1 PE=1 SV=1
17	Q9LT31	6.51e-07	55.5	520	0.059	0.102	VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana OX=3702 GN=VPS9A PE=1 SV=1
18	Q10NQ3	1.06e-04	48.1	480	0.040	0.075	VPS9A_ORYSJ Vacuolar protein sorting-associated protein 9A OS=Oryza sativa subsp. japonica OX=39947 GN=VPS9A PE=1 SV=1
19	Q6PAR5	1.29e-04	48.5	1458	0.031	0.019	GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gapvd1 PE=1 SV=2
20	Q14C86	1.32e-04	48.5	1478	0.031	0.019	GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16511 FERM_f0	25	16.6	N-terminal or F0 domain of Talin-head FERM
2	PF00788 RA	4.2e-09	48.2	Ras association (RalGDS/AF-6) domain
3	PF04221 RelB	6.1e+02	11.7	RelB antitoxin
4	PF02204 VPS9	7.9e-20	82.4	Vacuolar sorting protein 9 (VPS9) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273047	0.997	Ras-related protein Rab-5A
2	9606.ENSP00000353444	0.991	Ras-related protein Rab-5B
3	9606.ENSP00000447053	0.952	Ras-related protein Rab-5C
4	9606.ENSP00000407586	0.936	GTPase HRas
5	9606.ENSP00000350386	0.911	Rab proteins geranylgeranyltransferase component A 1
6	9606.ENSP00000355511	0.911	Rab proteins geranylgeranyltransferase component A 2
7	9606.ENSP00000394071	0.902	Rab GDP dissociation inhibitor alpha
8	9606.ENSP00000369538	0.901	Rab GDP dissociation inhibitor beta
9	9606.ENSP00000246792	0.800	Ras-related protein R-Ras
10	9606.ENSP00000333519	0.763	Sodium/potassium/calcium exchanger 3
11	9606.ENSP00000249071	0.712	Ras-related C3 botulinum toxin substrate 2
12	9606.ENSP00000277575	0.689	USP6 N-terminal-like protein
13	9606.ENSP00000356737	0.671	Golgin, RAB6 interacting
14	9606.ENSP00000245957	0.667	Cilia- and flagella-associated protein 61
15	9606.ENSP00000345008	0.643	Fibulin-5
16	9606.ENSP00000332247	0.641	V-type proton ATPase 116 kDa subunit a isoform 2
17	9606.ENSP00000335636	0.632	N-alpha-acetyltransferase 20
18	9606.ENSP00000365567	0.629	Transmembrane 9 superfamily member 2
19	9606.ENSP00000400113	0.627	Palmitoyltransferase ZDHHC13
20	9606.ENSP00000341071	0.601	Rho guanine nucleotide exchange factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.847	enzyme binding
GO:0051020	0.580	GTPase binding
GO:0031267	0.475	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0010810	0.986	regulation of cell-substrate adhesion
GO:0048522	0.981	positive regulation of cellular process
GO:2000145	0.971	regulation of cell motility
GO:2000147	0.956	positive regulation of cell motility
GO:0010811	0.948	positive regulation of cell-substrate adhesion
GO:0001952	0.945	regulation of cell-matrix adhesion
GO:0030334	0.917	regulation of cell migration
GO:0030335	0.910	positive regulation of cell migration
GO:0010632	0.838	regulation of epithelial cell migration
GO:0010594	0.769	regulation of endothelial cell migration
GO:0009987	0.718	cellular process
GO:0050793	0.699	regulation of developmental process
GO:0010634	0.607	positive regulation of epithelial cell migration
GO:0001954	0.513	positive regulation of cell-matrix adhesion
GO:0010595	0.504	positive regulation of endothelial cell migration
GO:0051094	0.487	positive regulation of developmental process
GO:0045595	0.481	regulation of cell differentiation
GO:0050896	0.436	response to stimulus
GO:0051716	0.390	cellular response to stimulus
GO:0045597	0.335	positive regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.798	organelle
GO:0043231	0.761	intracellular membrane-bounded organelle
GO:0016020	0.368	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]