StarFunc result for job id Q8WYP5

User Input

>input (2266 residues)
MRDLRAQVTSGLLPFPEVTLQALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSI
TGERLSAYRFSGVNEQPPVVLAVKEFSWQKRTGLLIGLEETEGSVLCLYDLGISKVVKAV
VLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLVDLCLDDLSCNQN
EVEASDLEVLTGIPAEVPHIRESVMRQGRHLCFQLVSPTGTAVSTLSYISRTNQLAVGFS
DGYLALWNMKSMKREYYIQLESGQVPVYAVTFQEPENDPRNCCYLWAVQSTQDSEGDVLS
LHLLQLAFGNRKCLASGQILYEGLEYCEERYTLDLTGGMFPLRGQTSNTKLLGCQSIEKF
RSHGDREEGVNEALSPDTSVSVFTWQVNIYGQGKPSVYLGLFDINRWYHAQMPDSLRSGE
YLHNCSYFALWSLESVVSRTSPHGILDILVHERSLNRGVPPSYPPPEQFFNPSTYNFDAT
CLLNSGVVHLTCTGFQKETLTFLKKSGPSLNELIPDGYNRCLVAGLLSPRFVDVQPSSLS
QEEQLEAILSAAIQTSSLGLLTGYIRRWITEEQPNSATNLRFVLEWTWNKVVLTKEEFDR
LCVPLFDGSCHFMDPQTIQSIQQCYLLLSNLNIVLSCFASEAREITERGLIDLSNKFVVS
HLICQYAQVVLWFSHSGLLPEGIDDSVQLSRLCYNYPVIQNYYTSRRQKFERLSRGKWNP
DCLMIDGLVSQLGERIEKLWKRDEGGTGKYPPASLHAVLDMYLLDGVTEAAKHSITIYLL
LDIMYSFPNKTDTPIESFPTVFAISWGQVKLIQGFWLIDHNDYESGLDLLFHPATAKPLS
WQHSKIIQAFMSQGEHRQALRYIQTMKPTVSSGNDVILHLTVLLFNRCMVEAWNFLRQHC
NRLNIEELLKHMYEVCQEMGLMEDLLKLPFTDTEQECLVKFLQSSASVQNHEFLLVHHLQ
RANYVPALKLNQTLKINVMNDRDPRLRERSLARNSILDQYGKILPRVHRKLAIERAKPYH
LSTSSVFRLVSRPKPLSAVPKQVVTGTVLTRSVFINNVLSKIGEVWASKEPINSTTPFNS
SKIEEPSPIVYSLPAPELPEAFFGTPISKASQKISRLLDLVVQPVPRPSQCSEFIQQSSM
KSPLYLVSRSLPSSSQLKGSPQAISRASELHLLETPLVVKKAKSLAMSVTTSGFSEFTPQ
SILRSTLRSTPLASPSPSPGRSPQRLKETRISFVEEDVHPKWIPGAADDSKLEVFTTPKK
CAVPVETEWLKSKDRTTSFFLNSPEKEHQEMDEGSQSLEKLDVSKGNSSVSITSDETTLE
YQDAPSPEDLEETVFTASKPKSSSTALTTNVTEQTEKDGDKDVFASEVTPSDLQKQMGNL
EDAETKDLLVAAEAFSELNHLSPVQGTEASLCAPSVYEGKIFTQKSKVPVLDEGLTSVET
YTPAIRANDNKSMADVLGDGGNSSLTISEGPIVSERRLNQEVALNLKEDHEVEVGVLKES
VDLPEEKLPISDSPPDTQEIHVIEQEKLEAQDSGEEARNLSFNELYPSGTLKLQYNFDTI
DQQFCDLADNKDTAECDIAEVDGELFVAQSNFTLILEGEEGEVEPGDFASSDVLPKAANT
ATEEKLVCSGENDNHGQIANLPSAVTSDQKSQKVDTLPYVPEPIKVAIAENLLDVIKDTR
SKEITSDTMEQSIHETIPLVSQNIMCPTKLVKSAFKTAQETSTMTMNVSQVDDVVSSKTR
TRGQRIQNVNVKSAQQEASADVATPKMPGQSVRKKTRKAKEISEASENIYSDVRGLSQNQ
QIPQNSVTPRRGRRKKEVNQDILENTSSVEQELQITTGRESKRLKSSQLLEPAVEETTKK
EVKVSSVTKRTPRRIKRSVENQESVEIINDLKVSTVTSPSRMIRKLRSTNLDASENTGNK
QDDKSSDKQLRIKHVRRVRGREVSPSDVREDSNLESSQLTVQAEFDMSAIPRKRGRPRKI
NPSEDVGSKAVKEERSPKKKEAPSIRRRSTRNTPAKSENVDVGKPALGKSILVPNEELSM
VMSSKKKLTKKTESQSQKRSLHSVSEERTDEMTHKETNEQEERLLATASFTKSSRSSRTR
SSKAILLPDLSEPNNEPLFSPASEVPRKAKAKKIEVPAQLKELVSDLSSQFVISPPALRS
RQKNTSNKNKLEDELKDDAQSVETLGKPKAKRIRTSKTKQASKNTEKESAWSPPPIEIRL
ISPLASPADGVKSKPRKTTEVTGTGLGRNRKKLSSYPKQILRRKML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5jT0	0.414	0.891	0.000	1004	0.443	1.000	7r5jT0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:Q8CJF7	0.524	0.529	0.000	2243	0.704	0.712	Q8CJF7.pdb.gz	ELYS_MOUSE Protein ELYS OS=Mus musculus OX=10090 GN=Ahctf1 PE=1 SV=1
3	AFDB:Q8WYP5	1.000	1.000	0.000	2266	1.000	1.000	Q8WYP5.pdb.gz	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
4	AFDB:X1WE68	0.467	0.421	0.000	2527	0.442	0.397	X1WE68.pdb.gz
5	AFDB:Q9VWE6	0.359	0.382	2.170E-56	2111	0.182	0.196	Q9VWE6.pdb.gz	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
6	AFDB:Q18508	0.274	0.339	4.177E-35	1784	0.135	0.172	Q18508.pdb.gz	MEL28_CAEEL Protein mel-28 OS=Caenorhabditis elegans OX=6239 GN=mel-28 PE=1 SV=2
7	PDB:7r5jR0	0.139	0.190	4.608E-11	1399	0.057	0.093	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
8	PDB:7r5jD4	0.174	0.259	1.155E-10	1312	0.051	0.088	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
9	PDB:7wooC	0.162	0.242	1.209E-10	1325	0.045	0.078	7wooC.pdb.gz
10	PDB:1xi4A	0.106	0.141	4.178E-10	1630	0.055	0.076	1xi4A.pdb.gz
11	PDB:7r5jK0	0.123	0.227	4.178E-10	1086	0.051	0.107	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:5a9qA	0.148	0.261	6.317E-10	1097	0.050	0.104	5a9qA.pdb.gz
13	PDB:7wooD	0.164	0.226	6.925E-10	1398	0.060	0.097	7wooD.pdb.gz
14	PDB:7qpgR	0.109	0.112	7.251E-10	2208	0.057	0.058	7qpgR.pdb.gz
15	PDB:6qk7A	0.097	0.149	1.817E-9	1161	0.047	0.092	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
16	AFDB:Q38EA0	0.082	0.080	2.682E-7	2324	0.127	0.124	Q38EA0.pdb.gz	Q38EA0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0580 PE=4 SV=1
17	AFDB:A0A0G2JZW4	0.075	0.074	9.705E-7	2308	0.122	0.120	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
18	AFDB:O95996	0.073	0.072	9.705E-7	2303	0.117	0.115	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
19	AFDB:Q5ADP3	0.064	0.097	6.381E-6	1080	0.074	0.156	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
20	AFDB:P35658	0.117	0.125	8.800E-6	2090	0.126	0.136	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CJF7	0.0	3087	2243	0.707	0.714	ELYS_MOUSE Protein ELYS OS=Mus musculus OX=10090 GN=Ahctf1 PE=1 SV=1
2	Q8WYP5	0.0	4665	2266	1.000	1.000	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
3	Q9VWE6	2.31e-47	190	2111	0.097	0.104	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
4	Q84JU6	5.16e-05	51.2	927	0.032	0.078	HOS1_ARATH E3 ubiquitin-protein ligase HOS1 OS=Arabidopsis thaliana OX=3702 GN=HOS1 PE=1 SV=1
5	Q18508	2.21e-04	49.3	1784	0.065	0.082	MEL28_CAEEL Protein mel-28 OS=Caenorhabditis elegans OX=6239 GN=mel-28 PE=1 SV=2
6	P43554	0.37	38.5	623	0.016	0.058	SWP82_YEAST SWI/SNF global transcription activator complex subunit SWP82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWP82 PE=1 SV=1
7	Q385Z9	0.55	37.7	509	0.017	0.077	Q385Z9_TRYB2 Tyrosine specific protein phosphatases domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1640 PE=4 SV=1
8	G0S2G1	1.8	35.8	299	0.020	0.151	ELYS_CHATD Protein ELYS OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=ELYS PE=1 SV=1
9	A8XSR2	3.9	35.0	1559	0.039	0.056	A8XSR2_CAEBR Protein CBR-MEL-28 OS=Caenorhabditis briggsae OX=6238 GN=mel-28 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13934 ELYS	7e-52	188.1	Nuclear pore complex assembly
2	PF16687 ELYS-bb	0	1031.1	beta-propeller of ELYS nucleoporin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367721	0.997	Nuclear pore complex protein Nup160
2	9606.ENSP00000229179	0.996	Nuclear pore complex protein Nup107
3	9606.ENSP00000261396	0.994	Nuclear pore complex protein Nup133
4	9606.ENSP00000448054	0.992	Nucleoporin Nup37
5	9606.ENSP00000342262	0.988	Nucleoporin Nup43
6	9606.ENSP00000373312	0.986	Protein SEC13 homolog
7	9606.ENSP00000245544	0.983	Nuclear pore complex protein Nup85
8	9606.ENSP00000382779	0.979	Nucleoporin SEH1
9	9606.ENSP00000316032	0.968	Nuclear pore complex protein Nup98-Nup96
10	9606.ENSP00000295119	0.955	Nucleoporin NUP53
11	9606.ENSP00000310668	0.944	Nuclear pore complex protein Nup93
12	9606.ENSP00000231498	0.934	Nuclear pore complex protein Nup155
13	9606.ENSP00000285968	0.930	Nuclear pore complex protein Nup205
14	9606.ENSP00000471191	0.925	Nuclear pore glycoprotein p62
15	9606.ENSP00000361658	0.891	Nucleoporin NUP188 homolog
16	9606.ENSP00000356448	0.879	Nucleoprotein TPR
17	9606.ENSP00000444029	0.877	Nuclear pore complex protein Nup153
18	9606.ENSP00000283195	0.876	E3 SUMO-protein ligase RanBP2
19	9606.ENSP00000345895	0.864	Nuclear pore complex protein Nup50
20	9606.ENSP00000378687	0.860	Nuclear envelope pore membrane protein POM 121

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.568	heterocyclic compound binding
GO:0097159	0.568	organic cyclic compound binding
GO:0003676	0.554	nucleic acid binding
GO:0003677	0.352	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071840	0.976	cellular component organization or biogenesis
GO:0016043	0.970	cellular component organization
GO:0050789	0.962	regulation of biological process
GO:0006999	0.949	nuclear pore organization
GO:0046931	0.928	pore complex assembly
GO:0050794	0.924	regulation of cellular process
GO:0048856	0.792	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0031981	0.999	nuclear lumen
GO:0032991	0.998	protein-containing complex
GO:0005829	0.998	cytosol
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0016020	0.993	membrane
GO:0005694	0.971	chromosome
GO:0005635	0.959	nuclear envelope
GO:0005654	0.958	nucleoplasm
GO:0140513	0.957	nuclear protein-containing complex
GO:0031090	0.954	organelle membrane
GO:0098687	0.944	chromosomal region
GO:0005643	0.930	nuclear pore
GO:0031965	0.924	nuclear membrane
GO:0099080	0.915	supramolecular complex
GO:0000775	0.892	chromosome, centromeric region
GO:0000793	0.879	condensed chromosome
GO:0000779	0.871	condensed chromosome, centromeric region
GO:0005576	0.862	extracellular region
GO:0000776	0.850	kinetochore
GO:0031982	0.801	vesicle
GO:0005615	0.753	extracellular space
GO:1903561	0.750	extracellular vesicle
GO:0031080	0.712	nuclear pore outer ring
GO:0000785	0.704	chromatin
GO:0070062	0.694	extracellular exosome
GO:0034399	0.445	nuclear periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]