StarFunc result for job id Q8WYQ3

User Input

>input (142 residues)
MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSA
VGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLS
LCEGFSEALKQCKYYHGLSSLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5MBW9	0.366	0.339	1.376E-17	149	1.000	0.953	B5MBW9.pdb.gz	B5MBW9_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
2	AFDB:Q7TNL9	0.449	0.460	7.995E-16	138	0.845	0.870	Q7TNL9.pdb.gz	Q7TNL9_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Mus musculus OX=10090 GN=Chchd10 PE=1 SV=1
3	AFDB:Q6PBP6	0.311	0.309	1.275E-10	143	0.662	0.657	Q6PBP6.pdb.gz	Q6PBP6_DANRE Coiled-coil-helix-coiled-coil-helix domain-containing 10 OS=Danio rerio OX=7955 GN=chchd2 PE=1 SV=1
4	AFDB:Q9Y6H1	0.295	0.283	3.243E-9	151	0.585	0.550	Q9Y6H1.pdb.gz	CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1
5	AFDB:Q09254	0.265	0.245	5.092E-8	154	0.500	0.461	Q09254.pdb.gz	HAR1_CAEEL Hemiasterlin resistant protein 1 OS=Caenorhabditis elegans OX=6239 GN=har-1 PE=4 SV=1
6	AFDB:B2RPU8	0.257	0.050	8.833E-8	756	0.577	0.108	B2RPU8.pdb.gz	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
7	AFDB:Q9VX77	0.288	0.241	1.086E-7	170	0.521	0.435	Q9VX77.pdb.gz	Q9VX77_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
8	PDB:6o3sA	0.233	0.545	2.073	47	0.028	0.085	6o3sA.pdb.gz
9	PDB:2rnbA	0.249	0.488	3.357	67	0.120	0.254	2rnbA.pdb.gz	A structural-dynamical characterization of human cox17
10	AFDB:Q9TZK8	0.146	0.044	3.988	832	0.190	0.032	Q9TZK8.pdb.gz	Q9TZK8_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=meg-4 PE=1 SV=1
11	AFDB:Q388D2	0.137	0.062	6.027	391	0.183	0.066	Q388D2.pdb.gz	Q388D2_TRYB2 SH3 domain protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1950 PE=4 SV=1
12	AFDB:A0A2R8PYZ9	0.138	0.049	6.457	474	0.204	0.061	A0A2R8PYZ9.pdb.gz
13	PDB:1f4nA	0.172	0.323	9.429	59	0.014	0.034	1f4nA.pdb.gz	Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WYQ3	9.61e-96	274	142	1.000	1.000	CHC10_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
2	B5MBW9	1.23e-92	266	149	1.000	0.953	B5MBW9_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
3	Q7TNL9	2.18e-65	197	138	0.838	0.862	Q7TNL9_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Mus musculus OX=10090 GN=Chchd10 PE=1 SV=1
4	Q8BW15	5.98e-65	196	138	0.831	0.855	Q8BW15_MOUSE Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial OS=Mus musculus OX=10090 GN=Chchd10 PE=2 SV=1
5	Q2V056	4.60e-57	174	98	0.599	0.867	Q2V056_MOUSE CHCH domain-containing protein OS=Mus musculus OX=10090 GN=Chchd10 PE=2 SV=1
6	Q6PBP6	2.54e-43	141	143	0.535	0.531	Q6PBP6_DANRE Coiled-coil-helix-coiled-coil-helix domain-containing 10 OS=Danio rerio OX=7955 GN=chchd2 PE=1 SV=1
7	Q9D1L0	3.14e-39	131	153	0.592	0.549	CHCH2_MOUSE Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Mus musculus OX=10090 GN=Chchd2 PE=2 SV=1
8	Q9Y6H1	2.95e-37	126	151	0.570	0.536	CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1
9	D3Z5B1	2.26e-35	122	183	0.458	0.355	D3Z5B1_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like (Fragment) OS=Mus musculus OX=10090 GN=Zbed5 PE=4 SV=8
10	Q8CEW7	3.86e-34	126	583	0.549	0.134	Q8CEW7_MOUSE DUF4371 domain-containing protein OS=Mus musculus OX=10090 GN=Zbed5 PE=2 SV=1
11	B2RPU8	1.12e-33	126	756	0.549	0.103	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
12	X2JFJ0	2.75e-24	92.4	122	0.387	0.451	X2JFJ0_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
13	Q9VX77	6.00e-24	92.8	170	0.387	0.324	Q9VX77_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
14	Q09254	7.33e-24	92.4	154	0.387	0.357	HAR1_CAEEL Hemiasterlin resistant protein 1 OS=Caenorhabditis elegans OX=6239 GN=har-1 PE=4 SV=1
15	Q03667	4.81e-17	74.7	156	0.387	0.353	MIX17_YEAST Mitochondrial intermembrane space cysteine motif-containing protein MIX17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIX17 PE=1 SV=1
16	Q59WV9	1.43e-14	68.2	151	0.387	0.364	Q59WV9_CANAL Mic17p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C600920WA PE=4 SV=1
17	Q10307	9.57e-10	55.8	172	0.303	0.250	YD52_SCHPO Uncharacterized protein C6C3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6C3.02c PE=4 SV=1
18	Q9LXC2	1.37e-04	41.6	139	0.303	0.309	Q9LXC2_ARATH At5g09570 OS=Arabidopsis thaliana OX=3702 GN=AT12CYS-2 PE=1 SV=1
19	Q5F8W9	0.002	39.7	756	0.134	0.025	Q5F8W9_NEIG1 site-specific DNA-methyltransferase (adenine-specific) OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=NGO_0641 PE=3 SV=1
20	Q2US45	0.16	33.9	1261	0.113	0.013	MYO1_ASPOR Myosin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=myoA PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06747 CHCH	0.0014	30.0	CHCH domain
2	PF08583 Cmc1	6.6e+02	11.8	Cytochrome c oxidase biogenesis protein Cmc1 like
3	PF09849 DUF2076	0.55	21.8	Uncharacterized protein conserved in bacteria (DUF2076)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418428

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378812	0.994	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
2	9606.ENSP00000262570	0.983	MICOS complex subunit MIC19
3	9606.ENSP00000290913	0.976	MICOS complex subunit MIC25
4	9606.ENSP00000387262	0.973	MICOS complex subunit MIC60
5	9606.ENSP00000362268	0.969	MICOS complex subunit MIC27
6	9606.ENSP00000295767	0.968	Mitochondrial intermembrane space import and assembly protein 40
7	9606.ENSP00000368528	0.957	MICOS complex subunit MIC26
8	9606.ENSP00000309561	0.952	MICOS complex subunit MIC13
9	9606.ENSP00000325655	0.944	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
10	9606.ENSP00000248114	0.942	FAD-linked sulfhydryl oxidase ALR
11	9606.ENSP00000261070	0.933	Cytochrome c oxidase copper chaperone
12	9606.ENSP00000342015	0.933	Cytochrome c oxidase assembly protein COX19
13	9606.ENSP00000355572	0.926	Cytochrome c oxidase assembly factor 6 homolog
14	9606.ENSP00000215570	0.925	Mitochondrial import inner membrane translocase subunit Tim13
15	9606.ENSP00000306425	0.925	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
16	9606.ENSP00000361993	0.922	Mitochondrial import inner membrane translocase subunit Tim8 A
17	9606.ENSP00000438455	0.915	Mitochondrial import inner membrane translocase subunit Tim8 B
18	9606.ENSP00000240185	0.908	TAR DNA-binding protein 43
19	9606.ENSP00000219400	0.902	COX assembly mitochondrial protein 2 homolog
20	9606.ENSP00000347919	0.900	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0065007	0.993	biological regulation
GO:0016043	0.985	cellular component organization
GO:0006996	0.982	organelle organization
GO:0050789	0.961	regulation of biological process
GO:0050794	0.953	regulation of cellular process
GO:0048518	0.892	positive regulation of biological process
GO:0048522	0.881	positive regulation of cellular process
GO:0007005	0.807	mitochondrion organization
GO:0051179	0.666	localization
GO:0051641	0.530	cellular localization
GO:0019222	0.526	regulation of metabolic process
GO:0044237	0.515	cellular metabolic process
GO:0044085	0.432	cellular component biogenesis
GO:0031323	0.429	regulation of cellular metabolic process
GO:0022607	0.416	cellular component assembly
GO:0051234	0.406	establishment of localization
GO:0006810	0.371	transport
GO:0050896	0.364	response to stimulus
GO:0061024	0.334	membrane organization
GO:0060255	0.330	regulation of macromolecule metabolic process
GO:0007006	0.303	mitochondrial membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.966	intracellular organelle lumen
GO:0016020	0.870	membrane
GO:0031967	0.855	organelle envelope
GO:0005740	0.560	mitochondrial envelope
GO:0032991	0.373	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]