StarFunc result for job id Q8WYR1

User Input

>input (880 residues)
MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAN
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQELA
SGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWSQDSFDI
LQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTSSLASHDSTLS
LASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK
FIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLP
QPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRR
LENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPW
EESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLL
YYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDG
DREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEV
VKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYK
PEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A4I3	0.763	0.770	0.000	872	0.861	0.869	D4A4I3.pdb.gz	D4A4I3_RAT Phosphoinositide-3-kinase, regulatory subunit 5 OS=Rattus norvegicus OX=10116 GN=Pik3r5 PE=1 SV=1
2	AFDB:L7RT34	0.817	0.817	0.000	880	1.000	1.000	L7RT34.pdb.gz	L7RT34_HUMAN Phosphoinositide-3-kinase, regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=4 SV=1
3	AFDB:O02696	0.846	0.849	0.000	877	0.892	0.895	O02696.pdb.gz	PI3R5_PIG Phosphoinositide 3-kinase regulatory subunit 5 OS=Sus scrofa OX=9823 GN=PIK3R5 PE=1 SV=1
4	PDB:7mezB	0.574	0.905	2.970E-63	547	0.591	0.951	7mezB.pdb.gz
5	PDB:4l02A	0.189	0.410	5.635E-6	360	0.036	0.089	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
6	PDB:1u0tB	0.122	0.352	5.456E-5	276	0.028	0.091	1u0tB.pdb.gz
7	PDB:1u0rD	0.146	0.372	8.169E-5	301	0.044	0.130	1u0rD.pdb.gz
8	PDB:2i2aA	0.152	0.423	1.741E-4	264	0.040	0.133	2i2aA.pdb.gz	NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
9	PDB:3afoA	0.112	0.251	3.355E-4	360	0.022	0.053	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
10	AFDB:Q7M6Y3	0.080	0.095	4.856E-4	660	0.087	0.117	Q7M6Y3.pdb.gz	PICAL_MOUSE Phosphatidylinositol-binding clathrin assembly protein OS=Mus musculus OX=10090 GN=Picalm PE=1 SV=1
11	PDB:2an1B	0.156	0.421	5.953E-3	281	0.034	0.107	2an1B.pdb.gz
12	AFDB:Q9P7Y8	0.066	0.066	8.616E-3	706	0.074	0.092	Q9P7Y8.pdb.gz	MID2_SCHPO Septin ring organizing protein mid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mid2 PE=1 SV=2
13	AFDB:A0A0R4IF44	0.062	0.042	1.501E-2	1792	0.095	0.047	A0A0R4IF44.pdb.gz
14	AFDB:Q9ZW32	0.054	0.056	1.501E-2	839	0.097	0.101	Q9ZW32.pdb.gz	Q9ZW32_ARATH At2g29510 OS=Arabidopsis thaliana OX=3702 GN=At2g29510 PE=1 SV=1
15	AFDB:O60242	0.083	0.057	1.660E-2	1522	0.101	0.058	O60242.pdb.gz	AGRB3_HUMAN Adhesion G protein-coupled receptor B3 OS=Homo sapiens OX=9606 GN=ADGRB3 PE=1 SV=2
16	AFDB:P06102	0.062	0.065	2.750E-2	836	0.082	0.086	P06102.pdb.gz	NOT3_YEAST General negative regulator of transcription subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOT3 PE=1 SV=2
17	AFDB:Q7K126	0.055	0.057	3.042E-2	844	0.100	0.104	Q7K126.pdb.gz	Q7K126_DROME CCR4-NOT transcription complex subunit 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Not3 PE=1 SV=1
18	PDB:2jcdA	0.050	0.112	6.377E-2	315	0.040	0.111	2jcdA.pdb.gz	Structure and Action of the N-Oxygenase Aurf from Streptomyces Thioluteus.
19	PDB:5ekqD	0.079	0.239	1.004E-1	219	0.032	0.128	5ekqD.pdb.gz
20	PDB:1qoyA	0.060	0.124	1.056E-1	303	0.041	0.119	1qoyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A4I3	0.0	1462	872	0.859	0.867	D4A4I3_RAT Phosphoinositide-3-kinase, regulatory subunit 5 OS=Rattus norvegicus OX=10116 GN=Pik3r5 PE=1 SV=1
2	J3KSW1	0.0	1787	879	0.999	1.000	J3KSW1_HUMAN Phosphoinositide-3-kinase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
3	L7RT34	0.0	1793	880	1.000	1.000	L7RT34_HUMAN Phosphoinositide-3-kinase, regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=4 SV=1
4	O02696	0.0	1528	877	0.892	0.895	PI3R5_PIG Phosphoinositide 3-kinase regulatory subunit 5 OS=Sus scrofa OX=9823 GN=PIK3R5 PE=1 SV=1
5	Q5SW28	0.0	1474	871	0.858	0.867	PI3R5_MOUSE Phosphoinositide 3-kinase regulatory subunit 5 OS=Mus musculus OX=10090 GN=Pik3r5 PE=1 SV=1
6	Q8WYR1	0.0	1793	880	1.000	1.000	PI3R5_HUMAN Phosphoinositide 3-kinase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
7	J3KT66	1.09e-55	188	93	0.106	1.000	J3KT66_HUMAN Phosphoinositide-3-kinase regulatory subunit 5 (Fragment) OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
8	Q5UE93	1.70e-26	118	754	0.133	0.155	PI3R6_HUMAN Phosphoinositide 3-kinase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PIK3R6 PE=1 SV=1
9	Q3U6Q4	7.31e-25	113	756	0.130	0.151	PI3R6_MOUSE Phosphoinositide 3-kinase regulatory subunit 6 OS=Mus musculus OX=10090 GN=Pik3r6 PE=1 SV=1
10	Q12769	0.59	36.6	1436	0.019	0.012	NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3
11	Q9W3W6	1.5	35.0	3313	0.025	0.007	Q9W3W6_DROME Small ovary, isoform A OS=Drosophila melanogaster OX=7227 GN=sov PE=1 SV=2
12	Q8LFQ6	2.9	32.3	135	0.023	0.148	GRXC4_ARATH Glutaredoxin-C4 OS=Arabidopsis thaliana OX=3702 GN=GRXC4 PE=2 SV=2
13	Q70UZ7	3.9	33.5	791	0.026	0.029	VWA2_MOUSE von Willebrand factor A domain-containing protein 2 OS=Mus musculus OX=10090 GN=Vwa2 PE=1 SV=1
14	Q3V5K0	5.4	33.1	1945	0.019	0.009	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2
15	U4PRY7	5.5	33.1	1956	0.019	0.009	U4PRY7_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=1
16	Q96JK9	6.8	32.7	1138	0.027	0.021	MAML3_HUMAN Mastermind-like protein 3 OS=Homo sapiens OX=9606 GN=MAML3 PE=1 SV=4
17	Q585U4	9.2	32.7	4246	0.030	0.006	Q585U4_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.85 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04691 ApoC-I	1.5e+02	13.7	Apolipoprotein C-I (ApoC-1)
2	PF10050 DUF2284	39	15.5	Predicted metal-binding protein (DUF2284)
3	PF10486 PI3K_1B_p101	0	1317.9	Phosphoinositide 3-kinase gamma adapter protein p101 subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352121	0.999	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
2	9606.ENSP00000366563	0.988	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
3	9606.ENSP00000289153	0.963	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
4	9606.ENSP00000263967	0.956	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
5	9606.ENSP00000262741	0.950	Phosphatidylinositol 3-kinase regulatory subunit gamma
6	9606.ENSP00000222254	0.939	Phosphatidylinositol 3-kinase regulatory subunit beta
7	9606.ENSP00000428056	0.933	Phosphatidylinositol 3-kinase regulatory subunit alpha
8	9606.ENSP00000364907	0.930	Tyrosine-protein kinase SYK
9	9606.ENSP00000480157	0.926	Phosphoinositide 3-kinase regulatory subunit 6
10	9606.ENSP00000289902	0.918	High affinity immunoglobulin epsilon receptor subunit gamma
11	9606.ENSP00000334448	0.911	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
12	9606.ENSP00000357869	0.910	Phosphatidylinositol 4-kinase beta
13	9606.ENSP00000346671	0.909	Tyrosine-protein kinase Fyn
14	9606.ENSP00000255882	0.907	Phosphatidylinositol 4-kinase alpha
15	9606.ENSP00000481878	0.904	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
16	9606.ENSP00000264864	0.900	Phosphatidylinositol 4-kinase type 2-beta
17	9606.ENSP00000265382	0.900	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
18	9606.ENSP00000308782	0.900	Platelet glycoprotein VI
19	9606.ENSP00000357883	0.900	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
20	9606.ENSP00000359665	0.900	Phosphatidylinositol 4-kinase type 2-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046935	1.000	1-phosphatidylinositol-3-kinase regulator activity
GO:0044877	0.986	protein-containing complex binding
GO:0031683	0.741	G-protein beta/gamma-subunit complex binding
GO:0003824	0.584	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0007165	0.991	signal transduction
GO:0048518	0.954	positive regulation of biological process
GO:0019222	0.920	regulation of metabolic process
GO:0007186	0.917	G protein-coupled receptor signaling pathway
GO:0048522	0.907	positive regulation of cellular process
GO:0031323	0.906	regulation of cellular metabolic process
GO:0042325	0.897	regulation of phosphorylation
GO:0043549	0.878	regulation of kinase activity
GO:0001932	0.830	regulation of protein phosphorylation
GO:0044093	0.818	positive regulation of molecular function
GO:0048583	0.741	regulation of response to stimulus
GO:0045859	0.733	regulation of protein kinase activity
GO:0009966	0.639	regulation of signal transduction
GO:1902531	0.620	regulation of intracellular signal transduction
GO:0009893	0.592	positive regulation of metabolic process
GO:0031325	0.525	positive regulation of cellular metabolic process
GO:0048584	0.482	positive regulation of response to stimulus
GO:0043085	0.461	positive regulation of catalytic activity
GO:0035556	0.416	intracellular signal transduction
GO:0045937	0.406	positive regulation of phosphate metabolic process
GO:0042327	0.355	positive regulation of phosphorylation
GO:0051347	0.324	positive regulation of transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043229	1.000	intracellular organelle
GO:0005829	1.000	cytosol
GO:0032991	0.991	protein-containing complex
GO:1902494	0.970	catalytic complex
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:1990234	0.962	transferase complex
GO:0098796	0.961	membrane protein complex
GO:0019898	0.955	extrinsic component of membrane
GO:0005815	0.946	microtubule organizing center
GO:0061695	0.943	transferase complex, transferring phosphorus-containing groups
GO:0005886	0.940	plasma membrane
GO:0034451	0.935	centriolar satellite
GO:0005942	0.919	phosphatidylinositol 3-kinase complex
GO:0043227	0.782	membrane-bounded organelle
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0031981	0.429	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]