StarFunc result for job id Q8WZ04

User Input

>input (291 residues)
MGTPWRKRKGIAGPGLPDLSCALVLQPRAQVGTMSPAIALAFLPLVVTLLVRYRHYFRLL
VRTVLLRSLRDCLSGLRIEERAFSYVLTHALPGDPGHILTTLDHWSSRCEYLSHMGPVKG
QILMRLVEEKAPACVLELGTYCGYSTLLIARALPPGGRLLTVERDPRTAAVAEKLIRLAG
FDEHMVELIVGSSEDVIPCLRTQYQLSRADLVLLAHRPRCYLRDLQLLEAHALLPAGATV
LADHVLFPGAPRFLQYAKSCGRYRCRLHHTGLPDFPAIKDGIAQLTYAGPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WZ04	1.000	1.000	2.219E-60	291	1.000	1.000	Q8WZ04.pdb.gz	TOMT_HUMAN Transmembrane O-methyltransferase OS=Homo sapiens OX=9606 GN=TOMT PE=1 SV=3
2	AFDB:A0A193KX02	0.882	0.990	9.530E-40	259	0.512	0.575	A0A193KX02.pdb.gz	TOMT_DANRE Transmembrane O-methyltransferase homolog OS=Danio rerio OX=7955 GN=tomt PE=2 SV=1
3	AFDB:O88587	0.809	0.886	1.554E-29	265	0.323	0.355	O88587.pdb.gz	COMT_MOUSE Catechol O-methyltransferase OS=Mus musculus OX=10090 GN=Comt PE=1 SV=2
4	AFDB:A0A140VJG8	0.781	0.837	1.752E-29	271	0.323	0.347	A0A140VJG8.pdb.gz	A0A140VJG8_HUMAN Catechol O-methyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:F4ZGF2	0.788	0.893	9.978E-29	256	0.309	0.352	F4ZGF2.pdb.gz	COMTA_DANRE Catechol O-methyltransferase A OS=Danio rerio OX=7955 GN=comta PE=1 SV=1
6	AFDB:Q8NKC1	0.662	0.685	3.768E-18	281	0.216	0.224	Q8NKC1.pdb.gz	COMT2_SCHPO Probable catechol O-methyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB21E7.04c PE=3 SV=1
7	AFDB:O42898	0.629	0.686	1.463E-16	266	0.186	0.203	O42898.pdb.gz	COMT1_SCHPO Probable catechol O-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.03 PE=1 SV=1
8	PDB:5zy6B	0.636	0.748	3.301E-15	245	0.186	0.220	5zy6B.pdb.gz	structural insight into spCOMT
9	AFDB:O07431	0.540	0.701	6.645E-14	220	0.196	0.259	O07431.pdb.gz	CAMT_MYCTU Catechol O-methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0187 PE=1 SV=1
10	PDB:6jclG	0.531	0.699	8.229E-13	219	0.168	0.224	6jclG.pdb.gz	Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
11	AFDB:Q9M266	0.535	0.537	4.992E-12	290	0.165	0.166	Q9M266.pdb.gz	Q9M266_ARATH S-adenosyl-L-methionine-dependent methyltransferases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=OMTF3 PE=1 SV=1
12	AFDB:Q8BIG7	0.506	0.557	5.300E-12	262	0.189	0.210	Q8BIG7.pdb.gz	CMTD1_MOUSE Catechol O-methyltransferase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Comtd1 PE=1 SV=1
13	PDB:5x7fA	0.486	0.701	1.061E-10	198	0.124	0.182	5x7fA.pdb.gz	Structure of a O-methyltransferase from Mycobacterium tuberculosis at 2.0 resolution
14	PDB:2pwyA	0.453	0.519	2.981E-8	251	0.144	0.167	2pwyA.pdb.gz	Crystal Structure of Thermus thermophilus tRNA m(1)A(58) Methyltransferase and Biophysical Characterization of Its Interaction with tRNA.
15	PDB:3c0kA	0.416	0.317	5.115E-8	395	0.096	0.071	3c0kA.pdb.gz
16	PDB:1sqfA	0.381	0.270	5.768E-8	425	0.082	0.056	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
17	PDB:3a4tA	0.444	0.493	8.777E-8	258	0.110	0.124	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
18	PDB:3v97A	0.426	0.201	9.896E-8	667	0.117	0.051	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
19	PDB:7mq8SD	0.440	0.524	9.896E-8	237	0.089	0.110	7mq8SD.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:1i9gA	0.428	0.468	1.418E-7	264	0.113	0.125	1i9gA.pdb.gz	Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WZ04	0.0	580	291	1.000	1.000	TOMT_HUMAN Transmembrane O-methyltransferase OS=Homo sapiens OX=9606 GN=TOMT PE=1 SV=3
2	A1Y9I9	8.26e-171	474	258	0.821	0.926	TOMT_MOUSE Transmembrane O-methyltransferase homolog OS=Mus musculus OX=10090 GN=Tomt PE=1 SV=1
3	A0A193KX02	2.32e-92	276	259	0.512	0.575	TOMT_DANRE Transmembrane O-methyltransferase homolog OS=Danio rerio OX=7955 GN=tomt PE=2 SV=1
4	O88587	4.18e-52	173	265	0.299	0.328	COMT_MOUSE Catechol O-methyltransferase OS=Mus musculus OX=10090 GN=Comt PE=1 SV=2
5	P22734	1.09e-50	169	264	0.289	0.318	COMT_RAT Catechol O-methyltransferase OS=Rattus norvegicus OX=10116 GN=Comt PE=1 SV=2
6	A0A140VJG8	1.38e-49	167	271	0.289	0.310	A0A140VJG8_HUMAN Catechol O-methyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
7	P21964	1.38e-49	167	271	0.289	0.310	COMT_HUMAN Catechol O-methyltransferase OS=Homo sapiens OX=9606 GN=COMT PE=1 SV=2
8	F4ZGF2	8.45e-46	157	256	0.289	0.328	COMTA_DANRE Catechol O-methyltransferase A OS=Danio rerio OX=7955 GN=comta PE=1 SV=1
9	Q8NKC1	3.50e-26	106	281	0.186	0.192	COMT2_SCHPO Probable catechol O-methyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBPB21E7.04c PE=3 SV=1
10	O42898	2.68e-19	87.4	266	0.189	0.207	COMT1_SCHPO Probable catechol O-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.03 PE=1 SV=1
11	Q9M266	1.05e-07	54.3	290	0.134	0.134	Q9M266_ARATH S-adenosyl-L-methionine-dependent methyltransferases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=OMTF3 PE=1 SV=1
12	O07431	3.86e-07	52.0	220	0.134	0.177	CAMT_MYCTU Catechol O-methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0187 PE=1 SV=1
13	Q9C9W3	1.85e-04	44.3	232	0.100	0.125	CAMT1_ARATH Putative caffeoyl-CoA O-methyltransferase At1g67980 OS=Arabidopsis thaliana OX=3702 GN=At1g67980 PE=2 SV=1
14	C7AE94	0.001	42.0	235	0.134	0.166	FAOMT_VITVI Flavonoid 3',5'-methyltransferase OS=Vitis vinifera OX=29760 GN=FAOMT PE=1 SV=1
15	A0A0S2UWT1	0.003	40.8	242	0.113	0.136	CAMT2_PETHY Caffeoyl-CoA O-methyltransferase 2 OS=Petunia hybrida OX=4102 GN=CCOAOMT2 PE=1 SV=1
16	Q9C5D7	0.005	39.7	232	0.100	0.125	CAMT3_ARATH Probable caffeoyl-CoA O-methyltransferase At4g26220 OS=Arabidopsis thaliana OX=3702 GN=At4g26220 PE=2 SV=1
17	Q9C9W4	0.005	40.0	233	0.089	0.112	TSM1_ARATH Tapetum-specific methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=TSM1 PE=1 SV=2
18	O49499	0.018	38.5	259	0.069	0.077	CAMT4_ARATH Caffeoyl-CoA O-methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CCOAOMT1 PE=1 SV=1
19	A0A0S2UWA5	0.022	38.1	248	0.107	0.125	CAMT3_PETHY Caffeoyl-CoA O-methyltransferase 3 OS=Petunia hybrida OX=4102 GN=CCOAOMT3 PE=1 SV=1
20	Q86VU5	0.049	37.0	262	0.144	0.160	CMTD1_HUMAN Catechol O-methyltransferase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMTD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13578 Methyltransf_24	2.8e-07	42.9	Methyltransferase domain
2	PF01596 Methyltransf_3	2.8e-11	54.6	O-methyltransferase
3	PF13847 Methyltransf_31	48	15.2	Methyltransferase domain
4	PF01135 PCMT	4.6	18.5	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305742

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000255084	0.924	Aldehyde dehydrogenase family 3 member B2
2	9606.ENSP00000261733	0.920	Aldehyde dehydrogenase, mitochondrial
3	9606.ENSP00000473990	0.919	Aldehyde dehydrogenase family 3 member B1
4	9606.ENSP00000345774	0.913	Fatty aldehyde dehydrogenase
5	9606.ENSP00000340684	0.912	Amine oxidase [flavin-containing] A
6	9606.ENSP00000367309	0.911	Amine oxidase [flavin-containing] B
7	9606.ENSP00000411821	0.909	Aldehyde dehydrogenase, dimeric NADP-preferring
8	9606.ENSP00000269582	0.906	Phenylethanolamine N-methyltransferase
9	9606.ENSP00000376776	0.905	Dopamine beta-hydroxylase
10	9606.ENSP00000369050	0.902	Cytochrome P450 1A1
11	9606.ENSP00000478561	0.902	Cytochrome P450 1B1
12	9606.ENSP00000253799	0.901	Retina-specific copper amine oxidase
13	9606.ENSP00000312326	0.901	Membrane primary amine oxidase
14	9606.ENSP00000403644	0.900	Aromatic-L-amino-acid decarboxylase
15	9606.ENSP00000354511	0.825	Catechol O-methyltransferase
16	9606.ENSP00000475028	0.754	UDP glucuronosyltransferase 2 family, polypeptide A2
17	9606.ENSP00000334276	0.752	UDP-glucuronosyltransferase 2B28
18	9606.ENSP00000387683	0.752	UDP-glucuronosyltransferase 2B11
19	9606.ENSP00000251566	0.744	UDP-glucuronosyltransferase 2A3
20	9606.ENSP00000362513	0.744	UDP-glucuronosyltransferase 1-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008171	1.000	O-methyltransferase activity
GO:0016206	0.986	catechol O-methyltransferase activity
GO:0005488	0.964	binding
GO:0005515	0.842	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044237	0.989	cellular metabolic process
GO:1901564	0.910	organonitrogen compound metabolic process
GO:1901360	0.879	organic cyclic compound metabolic process
GO:0009310	0.871	amine catabolic process
GO:1901615	0.857	organic hydroxy compound metabolic process
GO:0006725	0.840	cellular aromatic compound metabolic process
GO:0042417	0.824	dopamine metabolic process
GO:0042402	0.808	cellular biogenic amine catabolic process
GO:0019336	0.747	phenol-containing compound catabolic process
GO:0065007	0.320	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005886	0.986	plasma membrane
GO:0012505	0.962	endomembrane system
GO:0043227	0.959	membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:0043229	0.940	intracellular organelle
GO:0043231	0.929	intracellular membrane-bounded organelle
GO:0005783	0.744	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
EC:2.1.1.6	0.986	catechol O-methyltransferase.

[back to server]