StarFunc result for job id Q8WZ42

User Input

>input (1400 residues)
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR
ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA
DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV
VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS
EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK
IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA
VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP
GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT
DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA
TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK
EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV
TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE
AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA
APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK
LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP
KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY
RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP
KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY
VEPAAPLGAPTYIPTLEPVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A8Y1	0.166	0.332	9.809E-59	655	0.382	0.817	D4A8Y1.pdb.gz	D4A8Y1_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
2	AFDB:Q15746	0.097	0.075	9.467E-53	1914	0.199	0.145	Q15746.pdb.gz	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
3	AFDB:A0A2R8QPI1	0.144	0.659	7.535E-41	294	0.154	0.735	A0A2R8QPI1.pdb.gz
4	AFDB:Q90X22	0.088	0.095	4.742E-38	1276	0.156	0.171	Q90X22.pdb.gz
5	AFDB:E7F5U2	0.082	0.051	1.979E-32	2497	0.146	0.082	E7F5U2.pdb.gz
6	AFDB:Q3V1M1	0.073	0.046	6.604E-32	2594	0.164	0.088	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
7	AFDB:Q6WRI0	0.082	0.050	1.175E-31	2623	0.169	0.090	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
8	AFDB:Q9VZT8	0.096	0.094	2.402E-19	1443	0.121	0.117	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
9	PDB:6dldD	0.065	0.293	5.983E-15	269	0.046	0.238	6dldD.pdb.gz
10	PDB:5oj2B	0.065	0.118	6.663E-14	692	0.046	0.094	5oj2B.pdb.gz
11	AFDB:Q924C5	0.083	0.071	1.240E-12	1678	0.154	0.128	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
12	PDB:5c6wJ	0.058	0.303	2.236E-11	238	0.026	0.155	5c6wJ.pdb.gz
13	PDB:6dlfA	0.085	0.356	2.906E-11	236	0.029	0.169	6dlfA.pdb.gz
14	PDB:6feyB	0.067	0.418	5.742E-11	207	0.030	0.203	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
15	PDB:1e07A	0.062	0.125	6.051E-11	642	0.039	0.084	1e07A.pdb.gz
16	PDB:2rcjC	0.059	0.147	2.128E-10	523	0.044	0.119	2rcjC.pdb.gz
17	AFDB:F1R2D2	0.081	0.069	2.111E-9	1687	0.096	0.080	F1R2D2.pdb.gz
18	PDB:6vpyL	0.058	0.351	2.249E-9	209	0.024	0.163	6vpyL.pdb.gz
19	PDB:2qhrL	0.058	0.322	4.001E-9	218	0.027	0.174	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
20	PDB:3o3uN	0.085	0.163	4.217E-9	580	0.019	0.047	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZU83	0.0	2241	26931	0.856	0.045	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
2	A0A8I5ZUN3	0.0	2385	35375	0.899	0.036	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
3	A0A8I5ZX32	0.0	581	868	0.230	0.371	A0A8I5ZX32_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
4	A0A8I6A794	0.0	2247	5475	0.856	0.219	A0A8I6A794_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
5	A2ASS6	0.0	2405	35213	0.902	0.036	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
6	D4A8Y1	0.0	1010	655	0.383	0.818	D4A8Y1_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
7	O97791	0.0	2261	2000	0.874	0.612	O97791_RABIT Titin (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=titin PE=1 SV=1
8	Q8WZ42	0.0	2803	34350	1.000	0.041	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
9	M9PBJ1	5.86e-34	145	3664	0.088	0.034	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
10	Q0E8J3	5.90e-34	145	3640	0.088	0.034	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
11	M9PE03	7.18e-34	145	3536	0.088	0.035	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
12	Q0E8J5	3.63e-33	143	2960	0.088	0.042	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
13	Q7Z1Y4	4.07e-33	142	2935	0.088	0.042	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
14	Q9W053	4.07e-33	142	2935	0.088	0.042	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
15	Q0E8J4	4.20e-33	142	3079	0.088	0.040	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
16	V6CLP5	1.35e-32	141	4963	0.087	0.025	KETN1_CAEEL Kettin homolog OS=Caenorhabditis elegans OX=6239 GN=ketn-1 PE=1 SV=1
17	Q9I7U4	2.11e-28	127	18141	0.054	0.004	TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3
18	O01761	8.20e-28	125	8081	0.081	0.014	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
19	Q15772	1.90e-27	124	3267	0.089	0.038	SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens OX=9606 GN=SPEG PE=1 SV=4
20	Q62407	2.42e-26	120	3262	0.088	0.038	SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Speg PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	3.1e-09	48.1	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	6.5e-107	361.2	Immunoglobulin I-set domain
3	PF00047 ig	7.8e-41	149.5	Immunoglobulin domain
4	PF13895 Ig_2	3.5e-39	144.3	Immunoglobulin domain
5	PF13927 Ig_3	5.1e-67	233.7	Immunoglobulin domain
6	PF16681 Ig_5	1.3	20.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
7	PF11465 Receptor_2B4	0.00071	31.1	Natural killer cell receptor 2B4
8	PF09042 Titin_Z	2.1e-41	151.0	Titin Z
9	PF07686 V-set	6.2e-16	69.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000467141

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312624	0.999	Telethonin
2	9606.ENSP00000443495	0.999	Alpha-actinin-2
3	9606.ENSP00000484342	0.999	Nebulin
4	9606.ENSP00000363390	0.998	E3 ubiquitin-protein ligase TRIM63
5	9606.ENSP00000380349	0.997	Calpain-3
6	9606.ENSP00000386665	0.992	Four and a half LIM domains protein 2
7	9606.ENSP00000360762	0.991	Ankyrin repeat domain-containing protein 1
8	9606.ENSP00000411250	0.991	Next to BRCA1 gene 1 protein
9	9606.ENSP00000455507	0.987	Obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
10	9606.ENSP00000394770	0.981	Cardiomyopathy-associated protein 5
11	9606.ENSP00000361636	0.976	Troponin C, skeletal muscle
12	9606.ENSP00000307280	0.974	Myosin light chain 1/3, skeletal muscle isoform
13	9606.ENSP00000335153	0.974	Heat shock protein HSP 90-alpha
14	9606.ENSP00000385636	0.973	Obscurin-like protein 1
15	9606.ENSP00000306163	0.967	Ankyrin repeat domain-containing protein 2
16	9606.ENSP00000377941	0.967	Alpha-actinin-1
17	9606.ENSP00000431813	0.966	Cysteine and glycine-rich protein 3
18	9606.ENSP00000211998	0.963	Vinculin
19	9606.ENSP00000358866	0.951	Filamin-A
20	9606.ENSP00000321679	0.949	Ankyrin repeat domain-containing protein 23

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0045214	0.989	sarcomere organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0030017	0.988	sarcomere
GO:0031674	0.984	I band

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]