StarFunc result for job id Q8WZ64

User Input

>input (1704 residues)
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQL
ETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIES
LITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS
PPSPFFKFQGEMIVNDLYVPSSPILAPVRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGVS
GSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQGE
ALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE
CFQSLRRKNSKASKSRTQKALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGAS
AKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLY
QAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKED
FYLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQ
LFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGI
LKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSMKFYRGVKKKMKP
PTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEYDIWPPAGKERKRSITKNPKIG
GLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERASMVAHCLEHKD
DKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVI
EELNVVLQRSRTLPKELQDEQILK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LH27	0.284	0.290	0.000	1664	0.362	0.370	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
2	AFDB:Q8WZ64	1.000	1.000	0.000	1704	1.000	1.000	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
3	PDB:5jcpA	0.114	0.534	1.774E-14	361	0.054	0.255	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
4	AFDB:Q6DFV3	0.107	0.094	3.344E-13	1944	0.141	0.124	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
5	PDB:3ljuX	0.067	0.281	1.748E-12	373	0.045	0.204	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
6	AFDB:F8VVT9	0.101	0.139	8.520E-12	1192	0.094	0.134	F8VVT9.pdb.gz	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
7	AFDB:Q5T5U3	0.108	0.094	1.710E-11	1958	0.145	0.126	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
8	AFDB:Q9P227	0.110	0.125	4.764E-11	1491	0.123	0.141	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
9	AFDB:Q8C115	0.077	0.086	8.457E-11	1491	0.112	0.127	Q8C115.pdb.gz	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
10	AFDB:A0A1D8PLJ2	0.101	0.149	2.053E-8	1141	0.097	0.145	A0A1D8PLJ2.pdb.gz	A0A1D8PLJ2_CANAL Bem3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM3 PE=4 SV=1
11	PDB:6r3vA	0.102	0.796	1.553E-7	198	0.025	0.217	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:3cxlA	0.096	0.397	3.985E-7	402	0.026	0.112	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	AFDB:P91621	0.068	0.058	7.261E-7	2072	0.109	0.090	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
14	PDB:1xa6A	0.098	0.403	8.000E-7	399	0.025	0.108	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
15	PDB:5c2kA	0.101	0.423	9.425E-7	382	0.031	0.139	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:3lvqE	0.096	0.365	2.419E-6	420	0.029	0.117	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
17	AFDB:Q6ZNL6	0.067	0.076	4.200E-5	1462	0.078	0.091	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
18	PDB:7c3mA	0.048	0.129	2.926E-4	577	0.019	0.057	7c3mA.pdb.gz
19	PDB:4mk0A	0.055	0.139	1.705E-3	631	0.027	0.073	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:3o47A	0.056	0.269	1.850E-3	289	0.020	0.118	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140LH27	0.0	1026	1664	0.311	0.319	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
2	A0A8I6AQA1	0.0	862	1454	0.278	0.325	A0A8I6AQA1_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
3	E7EU13	0.0	868	1194	0.275	0.392	E7EU13_HUMAN ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=1
4	F1LM60	0.0	870	1443	0.278	0.328	F1LM60_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
5	Q8R5G7	0.0	836	1538	0.275	0.304	ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arap3 PE=1 SV=3
6	Q8WWN8	0.0	837	1544	0.279	0.308	ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ARAP3 PE=1 SV=1
7	Q8WZ64	0.0	3538	1704	1.000	1.000	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
8	Q96P48	0.0	861	1450	0.275	0.323	ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3
9	Q0KHR5	5.73e-37	155	1510	0.086	0.097	Q0KHR5_DROME Rho GTPase activating protein at 15B, isoform B OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=1 SV=1
10	Q8T3K2	8.59e-37	154	1226	0.086	0.119	Q8T3K2_DROME SD08167p OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=2 SV=1
11	Q9VX92	1.03e-36	154	1552	0.086	0.094	Q9VX92_DROME Rho GTPase activating protein at 15B, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP15B PE=1 SV=3
12	A0JMI1	1.09e-23	111	827	0.046	0.096	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
13	J3KNM6	4.46e-22	106	1036	0.046	0.076	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
14	F8VVT9	4.57e-22	106	1192	0.046	0.066	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
15	Q99490	5.95e-22	106	1192	0.046	0.066	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
16	Q54WI0	7.85e-22	105	1333	0.039	0.050	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
17	Q9XX14	8.35e-22	105	1107	0.044	0.068	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
18	Q4QQN0	1.33e-21	103	626	0.042	0.115	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
19	U6A022	1.58e-21	104	808	0.039	0.082	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
20	Q15057	1.68e-21	104	778	0.048	0.104	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01412 ArfGap	4.1e-30	115.7	Putative GTPase activating protein for Arf
2	PF04931 DNA_pol_phi	0.14	22.0	DNA polymerase phi
3	PF12814 Mcp5_PH	27	16.4	Meiotic cell cortex C-terminal pleckstrin homology
4	PF00169 PH	3.5e-42	154.5	PH domain
5	PF15413 PH_11	1e-05	37.3	Pleckstrin homology domain
6	PF08458 PH_2	3.6e+02	12.9	Plant pleckstrin homology-like region
7	PF20399 PH_20	0.48	21.9	PH domain
8	PF14593 PH_3	0.0002	32.7	PH domain
9	PF15406 PH_6	1.5e-06	39.8	Pleckstrin homology domain
10	PF15409 PH_8	0.095	24.3	Pleckstrin homology domain
11	PF15410 PH_9	7.8	18.1	Pleckstrin homology domain
12	PF00788 RA	0.036	26.0	Ras association (RalGDS/AF-6) domain
13	PF00620 RhoGAP	6e-37	138.2	RhoGAP domain
14	PF00536 SAM_1	8.4e-07	40.7	SAM domain (Sterile alpha motif)
15	PF07647 SAM_2	1.6e-06	39.4	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.969	Transforming protein RhoA
2	9606.ENSP00000298316	0.956	ADP-ribosylation factor 6
3	9606.ENSP00000440005	0.930	ADP-ribosylation factor 1
4	9606.ENSP00000357048	0.925	Coatomer subunit alpha
5	9606.ENSP00000407586	0.925	GTPase HRas
6	9606.ENSP00000348461	0.916	Ras-related C3 botulinum toxin substrate 1
7	9606.ENSP00000242285	0.906	Clathrin light chain A
8	9606.ENSP00000309415	0.906	Clathrin light chain B
9	9606.ENSP00000258739	0.904	ER lumen protein-retaining receptor 2
10	9606.ENSP00000329471	0.904	ER lumen protein-retaining receptor 1
11	9606.ENSP00000386918	0.904	ER lumen protein-retaining receptor 3
12	9606.ENSP00000357564	0.768	Ras-related protein Rab-13
13	9606.ENSP00000234313	0.665	Pleckstrin
14	9606.ENSP00000350716	0.627	Tumor suppressor candidate 1
15	9606.ENSP00000439182	0.616	Unconventional myosin-Ih
16	9606.ENSP00000264316	0.595	Tyrosine-protein kinase TXK
17	9606.ENSP00000312411	0.554	Protein phosphatase 1E
18	9606.ENSP00000340454	0.551	Rap1 GTPase-GDP dissociation stimulator 1
19	9606.ENSP00000362682	0.550	Olfactomedin-like protein 2A
20	9606.ENSP00000265080	0.543	Ras-specific guanine nucleotide-releasing factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005547	0.999	phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005515	0.992	protein binding
GO:0140677	0.449	molecular function activator activity
GO:0030234	0.438	enzyme regulator activity
GO:0030695	0.414	GTPase regulator activity
GO:0008047	0.301	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.869	cellular process
GO:0019222	0.562	regulation of metabolic process
GO:0031323	0.509	regulation of cellular metabolic process
GO:0048518	0.492	positive regulation of biological process
GO:0050896	0.468	response to stimulus
GO:0023051	0.457	regulation of signaling
GO:0048522	0.446	positive regulation of cellular process
GO:0051716	0.421	cellular response to stimulus
GO:0048583	0.410	regulation of response to stimulus
GO:0007154	0.402	cell communication
GO:0060255	0.398	regulation of macromolecule metabolic process
GO:0023052	0.357	signaling
GO:0051179	0.354	localization
GO:0080090	0.342	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005829	0.974	cytosol
GO:0012505	0.969	endomembrane system
GO:0005634	0.720	nucleus
GO:0070013	0.594	intracellular organelle lumen
GO:0031981	0.577	nuclear lumen
GO:0005654	0.410	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]