StarFunc result for job id Q8WZ73

User Input

>input (363 residues)
MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARK
QTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDIST
EMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSS
SAQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARVPAEDETQSIDSEDSFVPGRRAS
LSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGAE
DQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHV
FRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WZ73	1.000	1.000	2.032E-63	363	1.000	1.000	Q8WZ73.pdb.gz	RFFL_HUMAN E3 ubiquitin-protein ligase rififylin OS=Homo sapiens OX=9606 GN=RFFL PE=1 SV=1
2	AFDB:H7BYJ1	0.327	0.247	6.149E-25	507	0.402	0.288	H7BYJ1.pdb.gz	H7BYJ1_HUMAN Ring finger protein 34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
3	AFDB:A1Z971	0.298	0.159	2.570E-12	700	0.281	0.146	A1Z971.pdb.gz	A1Z971_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=dRNF34 PE=1 SV=1
4	AFDB:F4JWA1	0.162	0.073	4.237E-4	863	0.196	0.082	F4JWA1.pdb.gz	F4JWA1_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g04460 PE=1 SV=1
5	AFDB:A1L020	0.152	0.110	1.123E-2	520	0.124	0.087	A1L020.pdb.gz	MEX3A_HUMAN RNA-binding protein MEX3A OS=Homo sapiens OX=9606 GN=MEX3A PE=1 SV=1
6	AFDB:Q9R0Q1	0.124	0.071	2.508E-2	673	0.146	0.079	Q9R0Q1.pdb.gz	SYTL4_MOUSE Synaptotagmin-like protein 4 OS=Mus musculus OX=10090 GN=Sytl4 PE=1 SV=1
7	AFDB:Q8H0W3	0.085	0.090	1.332E-1	331	0.140	0.154	Q8H0W3.pdb.gz	RVE6_ARATH Protein REVEILLE 6 OS=Arabidopsis thaliana OX=3702 GN=RVE6 PE=2 SV=1
8	AFDB:P41832	0.093	0.029	1.417E-1	1953	0.129	0.024	P41832.pdb.gz	BNI1_YEAST Protein BNI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNI1 PE=1 SV=3
9	PDB:4r8pL	0.123	0.170	1.738E-1	254	0.050	0.071	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
10	AFDB:Q91V27	0.140	0.091	2.053E-1	590	0.168	0.103	Q91V27.pdb.gz	MELPH_MOUSE Melanophilin OS=Mus musculus OX=10090 GN=Mlph PE=1 SV=1
11	AFDB:O42108	0.104	0.097	2.629E-1	400	0.138	0.125	O42108.pdb.gz	O42108_CHICK LIM homeodomain OS=Gallus gallus OX=9031 GN=LH-2A PE=2 SV=1
12	PDB:5gm6a	0.099	0.265	5.290E-1	123	0.039	0.114	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:2c2lA	0.132	0.166	7.207E-1	281	0.047	0.060	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
14	PDB:5a31B	0.087	0.243	1.423	84	0.050	0.214	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
15	PDB:4kfzB	0.088	0.186	1.513	148	0.028	0.068	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
16	PDB:1zbuB	0.105	0.124	1.610	304	0.025	0.030	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
17	PDB:1b8tA	0.080	0.141	2.482	192	0.047	0.089	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
18	PDB:5tteB	0.108	0.093	3.826	442	0.050	0.041	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
19	PDB:3m62A	0.103	0.048	4.330	955	0.041	0.016	3m62A.pdb.gz
20	PDB:4qpjB	0.116	0.182	4.606	209	0.033	0.057	4qpjB.pdb.gz	Structural asymmetry in a conserved signaling system that regulates division, replication, and virulence of an intracellular pathogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZQM0	0.0	675	377	0.895	0.862	RFFL_MOUSE E3 ubiquitin-protein ligase rififylin OS=Mus musculus OX=10090 GN=Rffl PE=1 SV=1
2	Q8WZ73	0.0	755	363	1.000	1.000	RFFL_HUMAN E3 ubiquitin-protein ligase rififylin OS=Homo sapiens OX=9606 GN=RFFL PE=1 SV=1
3	Q6AYH3	3.60e-81	254	381	0.463	0.441	RNF34_RAT E3 ubiquitin-protein ligase RNF34 OS=Rattus norvegicus OX=10116 GN=Rnf34 PE=1 SV=1
4	Q99KR6	5.16e-81	254	376	0.477	0.460	RNF34_MOUSE E3 ubiquitin-protein ligase RNF34 OS=Mus musculus OX=10090 GN=Rnf34 PE=1 SV=1
5	Q969K3	6.05e-80	251	372	0.457	0.446	RNF34_HUMAN E3 ubiquitin-protein ligase RNF34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
6	H7BYJ1	7.02e-64	213	507	0.413	0.296	H7BYJ1_HUMAN Ring finger protein 34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
7	A1Z971	4.08e-39	149	700	0.242	0.126	A1Z971_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=dRNF34 PE=1 SV=1
8	G3V504	3.34e-25	102	163	0.171	0.380	G3V504_HUMAN Ring finger protein 34 (Fragment) OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
9	Q557E7	1.67e-10	64.7	665	0.069	0.038	CBLA_DICDI E3 ubiquitin-protein ligase cblA OS=Dictyostelium discoideum OX=44689 GN=cblA-1 PE=1 SV=1
10	H0YZU0	3.93e-09	60.1	485	0.061	0.045	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
11	Q8JHV9	6.30e-09	59.3	401	0.061	0.055	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
12	Q90660	2.28e-08	58.2	611	0.085	0.051	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
13	Q6PIA0	2.55e-08	56.2	236	0.066	0.102	Q6PIA0_HUMAN Baculoviral IAP repeat-containing 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=1
14	Q13490	2.69e-08	57.8	618	0.094	0.055	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
15	Q60989	3.36e-08	57.4	496	0.063	0.046	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
16	O08863	3.91e-08	57.4	600	0.061	0.037	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
17	P98170	4.17e-08	57.0	497	0.063	0.046	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
18	A0A0G2JTI9	6.67e-08	56.6	638	0.061	0.034	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
19	Q5XIW4	6.73e-08	56.6	602	0.061	0.037	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
20	F7FLN8	7.23e-08	56.6	602	0.061	0.037	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10208 ARMET_C	0.00046	30.9	ARMET, C-terminal
2	PF02318 FYVE_2	45	15.7	FYVE-type zinc finger
3	PF12949 HeH	13	16.9	HeH/LEM domain
4	PF14447 Prok-RING_4	0.9	20.8	Prokaryotic RING finger family 4
5	PF02037 SAP	0.43	21.7	SAP domain
6	PF13923 zf-C3HC4_2	18	16.5	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	6e-09	46.9	Zinc finger, C3HC4 type (RING finger)
8	PF13639 zf-RING_2	57	15.5	Ring finger domain
9	PF14634 zf-RING_5	22	16.4	zinc-RING finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.954	Cellular tumor antigen p53
2	9606.ENSP00000259808	0.923	Receptor-interacting serine/threonine-protein kinase 1
3	9606.ENSP00000441543	0.910	Polyubiquitin-C
4	9606.ENSP00000162749	0.900	Tumor necrosis factor receptor superfamily member 1A
5	9606.ENSP00000247668	0.900	TNF receptor-associated factor 2
6	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000304697	0.900	Polyubiquitin-B
8	9606.ENSP00000341268	0.900	Tumor necrosis factor receptor type 1-associated DEATH domain protein
9	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
10	9606.ENSP00000398698	0.900	Tumor necrosis factor
11	9606.ENSP00000337393	0.764	Protein UXT
12	9606.ENSP00000349722	0.699	Ubiquitin conjugating enzyme E2 D3
13	9606.ENSP00000356416	0.667	60 kDa SS-A/Ro ribonucleoprotein
14	9606.ENSP00000351416	0.663	Ankyrin repeat domain-containing protein 17
15	9606.ENSP00000444029	0.654	Nuclear pore complex protein Nup153
16	9606.ENSP00000345575	0.647	DnaJ homolog subfamily B member 12
17	9606.ENSP00000404381	0.640	DnaJ homolog subfamily B member 14
18	9606.ENSP00000401018	0.633	GINS complex subunit 3
19	9606.ENSP00000362273	0.602	Poly(ADP-ribose) glycohydrolase ARH3
20	9606.ENSP00000278836	0.601	Myelin regulatory factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002020	1.000	protease binding
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0002039	0.999	p53 binding
GO:0019901	0.998	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0042981	0.953	regulation of apoptotic process
GO:1902531	0.946	regulation of intracellular signal transduction
GO:0051246	0.942	regulation of protein metabolic process
GO:0048523	0.939	negative regulation of cellular process
GO:0070647	0.937	protein modification by small protein conjugation or removal
GO:0044237	0.927	cellular metabolic process
GO:0065009	0.925	regulation of molecular function
GO:2001233	0.924	regulation of apoptotic signaling pathway
GO:2001236	0.898	regulation of extrinsic apoptotic signaling pathway
GO:0006508	0.869	proteolysis
GO:0044260	0.857	cellular macromolecule metabolic process
GO:0030162	0.854	regulation of proteolysis
GO:0060548	0.829	negative regulation of cell death
GO:0023057	0.814	negative regulation of signaling
GO:0010648	0.814	negative regulation of cell communication
GO:0009056	0.802	catabolic process
GO:0050790	0.796	regulation of catalytic activity
GO:0048585	0.795	negative regulation of response to stimulus
GO:1901575	0.782	organic substance catabolic process
GO:0051172	0.776	negative regulation of nitrogen compound metabolic process
GO:0030163	0.770	protein catabolic process
GO:0043066	0.769	negative regulation of apoptotic process
GO:0010951	0.767	negative regulation of endopeptidase activity
GO:0009968	0.707	negative regulation of signal transduction
GO:2000117	0.704	negative regulation of cysteine-type endopeptidase activity
GO:1901796	0.691	regulation of signal transduction by p53 class mediator
GO:2001234	0.686	negative regulation of apoptotic signaling pathway
GO:1902041	0.636	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0051179	0.616	localization
GO:0060759	0.616	regulation of response to cytokine stimulus
GO:1902532	0.594	negative regulation of intracellular signal transduction
GO:0051603	0.565	proteolysis involved in protein catabolic process
GO:2001237	0.544	negative regulation of extrinsic apoptotic signaling pathway
GO:0016567	0.535	protein ubiquitination
GO:0050896	0.488	response to stimulus
GO:0001959	0.449	regulation of cytokine-mediated signaling pathway
GO:0051641	0.414	cellular localization
GO:0043154	0.411	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0019941	0.400	modification-dependent protein catabolic process
GO:0006511	0.392	ubiquitin-dependent protein catabolic process
GO:1901797	0.375	negative regulation of signal transduction by p53 class mediator
GO:0000209	0.374	protein polyubiquitination
GO:0031323	0.369	regulation of cellular metabolic process
GO:0048518	0.368	positive regulation of biological process
GO:0010803	0.357	regulation of tumor necrosis factor-mediated signaling pathway
GO:0051716	0.339	cellular response to stimulus
GO:0010498	0.303	proteasomal protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0031410	0.999	cytoplasmic vesicle
GO:0012505	0.998	endomembrane system
GO:0005654	0.997	nucleoplasm
GO:0005886	0.985	plasma membrane
GO:0031090	0.957	organelle membrane
GO:0098588	0.922	bounding membrane of organelle
GO:0005829	0.914	cytosol
GO:0012506	0.777	vesicle membrane
GO:0030659	0.744	cytoplasmic vesicle membrane
GO:0005768	0.742	endosome
GO:0010008	0.654	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]